Informazioni sul sito
Se vuoi aiutare LUOGOCOMUNE

HOMEPAGE
INFORMAZIONI
SUL SITO
MAPPA DEL SITO

SITE INFO

SEZIONE
11 Settembre
Questo sito utilizza cookies. Continuando la navigazione acconsenti al loro impiego.
 American Moon

Il nuovo documentario
di Massimo Mazzucco
 Login
Nome utente:

Password:


Hai perso la password?

Registrati ora!
 Menu principale
 Cerca nel sito

Ricerca avanzata

TUTTI I DVD DI LUOGOCOMUNE IN OFFERTA SPECIALE


storia & cultura : Gli anelli mancanti continuano ad aumentare
Inviato da Redazione il 10/8/2007 7:30:00 (24298 letture)

O sei Habilis, o sei Erectus: tutti e due non si può. Una nuova “picconata” alla teoria dell’evoluzionismo lineare arriva da una recente scoperta fatta in Kenya da una equipe diretta da Fred Spoor, dell'University College di Londra, e riportata nell’ultimo numero della rivista Nature.

Al gruppo di ricerca appartiene anche la nota paleontologa Meave Leakey, che già nel 2001 aveva dato un duro colpo alla semplicistica teoria lineare, che mette in ordine di tempo l’Australopithecus Afarensis (4 mil./anni), l’Homo Abilis (2 mil.), l’Homo Erectus(1 mil.), l’Homo Sapiens/Neanderthalis (100.000 anni), ed infine il Sapiens Sapiens (10.000 anni), ciascuna come diretta evoluzione della specie precedente. In quell’occasione infatti la Leakey aveva trovato un cranio di oltre 3 milioni di anni – il Kenyanthropus Platyops, o “Uomo del Kenya dal volto piatto” - le cui caratteristiche erano molto diverse da quelle del suo contemporaneo Afarensis.

Ora invece un reperto di Homo Erectus, databile nella stessa epoca dell’Homo Abilis, confuta anche l’ipotesi della discendenza del primo dal secondo, mentre le caratteristiche dentarie del primo indicano che si trattasse di un carnivoro, e quelle del secondo che si trattasse di un vegetariano.

Specie diverse, quindi, che non sarebbero mai nemmeno entrate in competizione fra di loro, suggerendo chiaramente una evoluzione parallela delle varie specie conosciute. Per non parlare ovviamente dell’Ominide di Flores, l’ “Hobbitt”, che ribalta persino i più azzardati teoremi alternativi.

Quello che sconcerta è la facilità - oltre alla frequenza - con cui crollano teorie che fino a ieri venivano date per buone. Ricordate Lucy, ad esempio? Nonostante la gran fanfara con cui fu data la notizia, ...


... oggi dobbiamo riconoscere che la piccola nonnina africana non è affatto la nostra comune progenitrice. Almeno non lo è di certo.

Man mano che gli “anelli mancanti” aumentano, il nostro albero genealogico prende sempre più le forme di un cespuglio senza radici, mentre la teoria evoluzionistica nel suo insieme appare come un colabrodo senza contorni, nel quale i buchi sono ormai la cosa più visibile: dalle impossibilità statistiche delle prime formazioni di aminoacidi, nello stagno primordiale, alla troppo geniale “invenzione” del DNA/RNA, fino al caos più totale nella transizione da primate a uomo, l’unica cosa su cui concordano tutti i paleontologi, a questo punto, è che l’Africa sia stata la culla dell’umanità.

Un pò pochino, per una scienza che continua ad arrogarsi il diritto di raccontarci come siamo venuti al mondo, ma non sa nemmeno da che parte cominciare per dimostrarlo.

Massimo Mazzucco

L’ articolo di Nature.

Mauro Quagliati ha scritto una scheda approfondita sugli Hobbit (Uomo di Flores), ponendo interrogativi che vanno ben oltre la semplice comparsa di questo nostro piccolo "cugino" nella lontana isola indonesiana: Il mistero dell'Hobbit - Un antenato in miniatura

Vedi anche: Gli Hobbit esistevano davvero - Un altro duro colpo per il darwinismo classico

Darwin, necessario ma non sufficiente? Segue una discussione particolarmente approfondita e interessante.

Le due cattedrali Un confronto fra il dogmatismo religioso e quello scientifico.

Breve storia dell'evoluzione (articolo ironico)

Voto: 7.00 (3 voti) - Vota questa news - OK Notizie


Altre news
28/11/2015 10:00:00 - Il nuovo sito è pronto
26/11/2015 19:40:00 - Fulvio Grimaldi a Matrix
24/11/2015 11:00:00 - Caccia russo abbattuto dai turchi
22/11/2015 20:20:00 - Ken O'Keefe: "ISIS = Israeli Secret Intelligence Service"
21/11/2015 21:00:00 - L'uomo che uccise Kennedy
19/11/2015 19:00:00 - La solitudine
18/11/2015 21:21:31 - Vladimir Putin - conferenza stampa al summit del G20
17/11/2015 13:50:00 - Dopo Parigi
15/11/2015 22:30:00 - Commenti liberi
14/11/2015 9:40:00 - À la guerre comme à la guerre
13/11/2015 23:00:00 - Nuovi attentati a Parigi
11/11/2015 19:50:00 - Atleti russi dopati, brutti e cattivi
10/11/2015 19:30:00 - Fini, Grillo, Travaglio - e il giornalismo che non fa i conti con sé stesso
9/11/2015 18:30:00 - "Bag it!" Documentario (Ita)
8/11/2015 9:09:03 - Commenti liberi

I commenti sono proprietà dei rispettivi autori. Non siamo in alcun modo responsabili del loro contenuto.
Autore Albero
fiammifero
Inviato: 10/8/2007 8:44  Aggiornato: 10/8/2007 8:44
Sono certo di non sapere
Iscritto: 28/2/2005
Da: ROMA
Inviati: 5691
 Re: Gli anelli mancanti continuano ad aumentare
Mah! tutti alla ricerca del nome a cui indirizzare qualche imprecazione per non cadere nella blasfemia
o si sta cercando qualche altro copyrigt ?

Citazione:
le cose di cui ci sentiamo assolutamente certi non sono mai vere (Oscar Wilde)
Wintermute
Inviato: 10/8/2007 9:47  Aggiornato: 10/8/2007 9:47
Dubito ormai di tutto
Iscritto: 11/1/2006
Da: aree riservate e protette
Inviati: 1096
 Re: Gli anelli mancanti continuano ad aumentare

scusate lassù in redazione, ma allora io non ho capito:
(premesso che in realtà le teorie evoluzionistiche sono forse tra le cose più certe e confermate che ci siano, di più della Relatività e di più del fatto che 1+1=10, certo se ci si ferma solo all'aspetto folkloristico...)
Se le teorie darwiniane sono errate (mettiamoci una multibenda foderata su entrambi gli occhi e facciamo finta sia così), allora come cavolo è spuntato tutto ciò che vediamo?

Dio da un giorno all'altro?
è stato carino allora a sotterrarci delle ossa finte! come quelli della kinder, ti mettono la sorpresina dentro l'ovetto e "una sorpresa su cinque sarà uno di noi" e se magari becchi quella/e giusta puoi perfino ricostruire un modello in scala dei prototipi abbandonati (per insufficienza di fondi?)
E poi la totale mancanza di stile: ha ideato e generato il Più Complesso Giocattolo Biologico che esista (DNA/RNA e baracca cellulare-senza contare l'Io senziente e tutto il resto) e l'ha piazzato così, sopra un sasso alla deriva del Nulla, senza un po' di phatos, ne di trama, nulla di nulla. ieri non c'era, oggi (o dopo i canonici 7 giorni) c'è tutto. inizino le danze...
allora è 10^333 volte meno Figo® di quello che pensavo...
è l'equivalente di un prestigiatore (certo, con molta più Immaginazione)...

sono stati gli UFi/rettilobestie/IlluminatiDalCielo?
a parte che almeno l'autografo o una scrittina di Copyright (per non parlare del Manuale) ce lo potevano anche lasciare ("Made in Bhoghtomosghotiwahaha"), si torna al punto d'origine: chi ha creato costoro?
avevano così tanto carisma da autocrearsi?

Siamo spuntati come funghi?
siamo una simulazione?


insomma, trovo molto semplice dire "così non può essere" e non fornire alternativa alcuna...
ciao!


ps: il ritrovamento di quel fossile ha riscritto le teorie sull'uomo, non le ha demolite come qualche -ridicolo- scribacchino ha riportato sui giornali...
ps2: LOL, bellissimo l'ultimo articolo linkato

Salvo il mondo...
ma con quale estensione?
robertodk
Inviato: 10/8/2007 10:23  Aggiornato: 10/8/2007 10:23
So tutto
Iscritto: 15/8/2006
Da:
Inviati: 11
 Re: Gli anelli mancanti continuano ad aumentare
e questi cosi qui dove li collochiamo allora? io un idea me la sono fatta. http://it.youtube.com/watch?v=PjTvTcENXF4

Mario860
Inviato: 10/8/2007 11:32  Aggiornato: 10/8/2007 11:32
So tutto
Iscritto: 17/7/2007
Da:
Inviati: 11
 Re: Gli anelli mancanti continuano ad aumentare
Premetto una cosa:
L'evoluzionismo è uno dei capisaldi della scienza moderna, ciononostante può/deve esssere perfezionato di fronte a nuovi fatti (TUTTE le scienze progrediscono con l'aggiunta di nuovi dati che modificano le teorie precedenti. Questo ultimo punto è il cardine stesso della scienza moderna)

Detto questo vorrei porre alla vostra attenzione alcune notizie che spero possano attrarre la vostra attenzione:

LO STRANO CASO DELL’ANTENATO PIGMEO: L'HOBBIT
http://mmmgroup.altervista.org/i-flores.html

L’ABORIGENO AUSTRALIANO:UN HOMO SAPIENS ARCAICO?
http://mmmgroup.altervista.org/i-aborig.html

Photo Gallery (La foto dei crani provenienti da Ica (Perù) e Merida (Messico))
http://mmmgroup.altervista.org/i-gall.html

Photo Gallery (la foto del "gigante" scoperto nel 1895 da Mr. Dyer in Irlanda)
http://mmmgroup.altervista.org/i-gall2.html

E' comunque l'intero sito ad esser fatto bene e credo che meriti un'occhiata, se non altro per stuzzicare la fantasia e la curiosità dei lettori.
http://mmmgroup.altervista.org/i-menu.html

Ciao.

Freeman
Inviato: 10/8/2007 11:33  Aggiornato: 10/8/2007 11:33
Dubito ormai di tutto
Iscritto: 31/7/2006
Da: NiggahCity
Inviati: 2092
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
insomma, trovo molto semplice dire "così non può essere" e non fornire alternativa alcuna...

La logica è semplice, infatti, non cadere anche tu nelle fallacie argomentative tipiche dei "debunkers".
Se io scopro una o più incongruenze logiche in una teoria, tanto da non renderla più "vera", non sono tenuto poi automaticamente ad enunciare "quella vera".
In altre parole, se scopro che una teoria è, da un punto di vista logico, falsa, non è detto che io debba per forza sapere quale sia quella vera.

"Non siamo noi a trovare la Verità. È la Verità a trovare noi. Dobbiamo solo prepararci. Si può invitare un ospite che non si conosce? No. Ma si può mettere la casa in ordine, così che, quando l'ospite arriva, si è pronti a riceverlo e a conoscerlo".
Davide71
Inviato: 10/8/2007 11:51  Aggiornato: 10/8/2007 11:51
Dubito ormai di tutto
Iscritto: 8/7/2006
Da:
Inviati: 2108
 Re: Gli anelli mancanti continuano ad aumentare
Ciao a tutti: un conto é individuare un percorso che porta dai primi esseri unicellulari all'uomo, un altro conto é individuare un percorso che porti dalla scimmia all'uomo.
Il primo percorso é innegabile, anche se ci sarebbe da discutere sul "come".
Insomma, ritenere che un organismo unicellulare possa avere generato uno pluricellulare é ancora oggi una pura e semplice opinione, suffragata dal fatto che gli scienziati non saprebbero a cos'altro pensare...
Tuttavia la stratigrafia delle forma di vita mostra un percorso incontestabile...
Il secondo percorso é praticamente un invenzione dei Leakey che non supererebbe nessun serio esame scientifico. Ma qualunque alternativa implicherebbe l'intervento di un qualcosa di cui gli scienziati non intendono ammettere l'esistenza...
Esattamente come i preti del '500, che pensavano che la Terra fosse piatta!

Non date le perle ai cani e ai porci perchè non le mangeranno e vi si rivolteranno contro.
mangano
Inviato: 10/8/2007 12:04  Aggiornato: 10/8/2007 12:04
So tutto
Iscritto: 12/7/2007
Da: Avigliana (TO)
Inviati: 26
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Ora invece un reperto di Homo Erectus, databile nella stessa epoca dell’Homo Abilis, confuta anche l’ipotesi della discendenza del primo dal secondo, mentre le caratteristiche dentarie del primo indicano che si trattasse di un carnivoro, e quelle del secondo che si trattasse di un vegetariano.


Massimo scusami, ma non sarà piuttosto il contrario? mi spiego: ciò che confuta l'ipotesi di discendenza da erectus a abilis sono le caratteristiche dentarie, non il fatto che siano convissuti. Sbaglio?

secondo me ha perfettamente ragione turbonegro quando dice: Citazione:
se scopro che una teoria è, da un punto di vista logico, falsa, non è detto che io debba per forza sapere quale sia quella vera.


oltretutto, questo non vuol neanche dire che la teoria precedente sia automaticamente vera.

"Vuolsi così colà dove si puote ciò che si vuole e più non dimandare"
Wintermute
Inviato: 10/8/2007 12:12  Aggiornato: 10/8/2007 12:12
Dubito ormai di tutto
Iscritto: 11/1/2006
Da: aree riservate e protette
Inviati: 1096
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
La logica è semplice, infatti, non cadere anche tu nelle fallacie argomentative tipiche dei "debunkers".

okkio però: la logica non ha "partito".
sono gli stessi identici metodi che usano i debunkers a farci dire che il 9/11 e successo quello che è (auto)successo.
Citazione:
Se io scopro una o più incongruenze logiche in una teoria, tanto da non renderla più "vera", non sono tenuto poi automaticamente ad enunciare "quella vera".
In altre parole, se scopro che una teoria è, da un punto di vista logico, falsa, non è detto che io debba per forza sapere quale sia quella vera.

è vero, ma mi risulta difficile discutere di qualcosa se non so da dove parte il prossimo.
magari la pensiamo uguale solo con qualche strato di precisazioni in più, oppure magari siamo totalmente in disaccordo, chi lo sa...

...questo ovviamente ignorando la sostanziale correttezza delle teorie di darwin

Salvo il mondo...
ma con quale estensione?
yarebon
Inviato: 10/8/2007 12:24  Aggiornato: 10/8/2007 12:24
Dubito ormai di tutto
Iscritto: 25/10/2005
Da:
Inviati: 2366
 Re: Gli anelli mancanti continuano ad aumentare
probabilmente la scienza non tiene conto di alcuni elementi, sul fatto che tanto naturale l'evoluzione dell'uomo non é, ma appunto per la scienza questo è impossibile, quindi in sintesi non troverà mai una spiegazione

vulcan
Inviato: 10/8/2007 14:02  Aggiornato: 10/8/2007 14:04
Dubito ormai di tutto
Iscritto: 29/1/2005
Da: Sardigna
Inviati: 2092
 Re: Gli anelli mancanti continuano ad aumentare
A suo tempo questa discussione sul Darwinismo negli articolo indicati da Massimo è stata avvincente e per molti passionale.. personalmente non saprei più cosa aggiungere ..se non ripetizioni ..

solo una riflessione, prendendo in considerazione il prodotto “più avanzato” di una possibile evoluzione ed il suo ambiente ;

l'osservazione cioè che la nicchia ecologica che l'uomo occupa all'interno non solo dell'universo circostante, ma anche all'interno stesso del pianeta è veramente da considerarsi marginale minimale e fragile per la sopravvivenza stessa.

Possiamo sopravvivere solo al di sotto dell'atmosfera e solo sulla terra emersa a determinate condizioni!

Mi domando fino a che punto, veramente, un processo casuale fatto di mutazioni casuali (per miliardi e miliardi di eventi genetici casuali) possa essere in grado di forgiare un essere .. casualmente ..cosi evoluto in una linea evolutiva .. casuale ..che a tutti i costi vogliamo spiegarci da “scienziati” come lineare e”logica”.

un po troppe casualità!
??

"Indaga le parole a partire dalle cose e non le cose a partire dalle parole." Misone
olah
Inviato: 10/8/2007 14:08  Aggiornato: 10/8/2007 14:36
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Questa scoperta scardina lo schema che delineava la nostra linea di discendenza, non sappiamo infatti se l'erectus discende dall'habils e se noi discendiamo da una di queste due specie. Ad ogni modo, il fatto che due specie siano coesistite non comporta necessariamente che una non possa essere derivata dall'altra. Una specie infatti può ramificarsi senza estinguersi.

Non ho capito perché questa scoperta dovrebbe essere una picconata all'evoluzionismo. Ammettiamo che si dimostri che l'erectus non derivi dall'habilis: ciò non implica che l'erectus non possa aver avuto origine da un'altra specie. L'unico modello messo in crisi è quello che traccia una linea di discendenza diretta habilis -> erectus.

C'è comunque una certa differenza nel parlare di evoluzione a livello di philum, genere o specie. Una cosa è dire che deriviamo da un primate, un'altra scoprire da quale specie. Chiaro che più si entra nel dettaglio e più è facile fare errori.

-- citazione
Quello che sconcerta è la facilità - oltre alla frequenza - con cui crollano teorie che fino a ieri venivano date per buone.

Perché sconcertante? Basta un'evidenza contraria a confutare una teoria, è nell'ordine delle cose. Succede continuamente in tutti i campi: si costruiscono modelli, si confutano, si cancellano o si migliorano. Buona parte dei modelli proposti negli articoli e delle nelle review di quest'anno saranno da rivedere l'anno prossimo.

-- citazione
impossibilità statistiche delle prime formazioni di aminoacidi

I sistemi caotici producono forme estremamente complesse partendo da algoritmi molto semplici. Gli aminoacidi sono molecole semplici e si possono produrre in molti modi.

-- citazione
alla troppo geniale “invenzione” del DNA/RNA

Esiste una tecnica di laboratorio per produrre ribozimi (RNA con attività enzimatica) utilizzando i meccanismi dell'evoluzione: mutazioni e selezioni. Il bello è che funziona. Perché ti sembra impossibile che in centinaia di milioni di anni non si siano potute selezionare molecole di RNA in grado di replicarsi attraverso stampi di DNA?

-- citazione
Un pò pochino, per una scienza che continua ad arrogarsi il diritto di raccontarci come siamo venuti al mondo

La scienza è metodo, non legge. Tutte le teorie sono confutabili, senza drammi. Quando Einstein ha proposto un nuovo modello per spiegare la gravità, nessuno ha dato del cretino a Newton. Forse anche la teoria di Einstein non è perfetta, gli scienziati continuano a fare il proprio mestiere, i modelli migliorano e diventano via via più precisi, le mele continuano a cadere dagli alberi.

olah
Inviato: 10/8/2007 14:29  Aggiornato: 10/8/2007 14:30
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
-- citazione
Mi domando fino a che punto, veramente, un processo casuale fatto di mutazioni casuali (per miliardi e miliardi di eventi genetici casuali) possa essere in grado di forgiare un essere .. casualmente ..cosi evoluto in una linea evolutiva .. casuale ..che a tutti i costi vogliamo spiegarci da “scienziati” come lineare e”logica”.

Semplice: ci troviamo in un sistema caotico.

Prendi ad esempio un frattale: può contenere figure decisamente complesse. All'interno del caos di un frattale ci possono essere strutture molto ordinate.

Eppure, i frattali si possono generare dalla reiterazione di algoritmi banali, molto semplici.

L'esempio dei frattali non è casuale: molte strutture naturali hanno geometrie frattali: il guscio delle chiocciole, i rami degli alberi, gli alveoli polmonari, i carciofi, i cavolfiori...

Redazione
Inviato: 10/8/2007 14:47  Aggiornato: 10/8/2007 15:12
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
WINTERMUTE: "insomma, trovo molto semplice dire "così non può essere" e non fornire alternativa alcuna..."

L’alternativa esiste, ed è molto semplice: siamo creature di una Entità superiore. Talmente superiore che con la nostra piccola mente non siamo in grado di comprenderne la logica, per cui affrontiamo il Problema applicando la nostra (vedi punto 2), con risultati decisamente penosi.

TUTTI: Se Vulcan non ha più niente da aggiungere alle vecchie discussioni, a me viene il mal di pancia al solo pensiero di ricominciare. E' stato davvero un confronto epico, piacevolmente corretto, ma estenuante.

I link alle vecchie discussioni sono stati messi anche per quello. Nessuno può pretendere che i nuovi arrivati le leggano per intero, ma sottolineo solo un paio di conclusioni importanti a cui eravamo arrivati:

1 - Evoluzione ed Evoluzionismo sono due cose diverse. La prima individua i passaggi morfologici all’interno delle specie (Darwinismo, in senso lato), la seconda vuole spiegare la nostra presenza sulla Terra grazie a questi passaggi.

Nessuno nega, credo, che l’Evoluzione esista: i fossili stanno lì a dimostrarcelo. Mentre molti dubitano che questo sia sufficiente a spiegare la nostra presenza nell’Universo. Tutto qui.

2 - Contraporre Evoluzionismo e Creazionismo come due teorie reciprocamente escludentesi è uno schema limitativo, che fa molto comodo ad ambedue le parti: siccome è molto facile dimostrare, dal fronte opposto, che ciascuna teoria non regge, si usa questa presunta “scelta obbligata” per dimostrare valida la propria teoria. In realtà, nessuno è in grado di sostenere che tertium non datur.

Per il resto... buon divertimento

Redazione
Inviato: 10/8/2007 15:05  Aggiornato: 10/8/2007 15:24
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
OLAH: "L'esempio dei frattali non è casuale: molte strutture naturali hanno geometrie frattali: il guscio delle chiocciole, i rami degli alberi, gli alveoli polmonari, i carciofi, i cavolfiori..."

... i semi di girasole, la pigna, le geometrie delle galassie.... l'Universo stesso, forse?

Io trovo particolarmente interessante, a sua volta, che queste geometrie "naturali" siano TUTTE basate sullo stesso rapporto di 1,66. Che è poi lo stesso identico rapporto che trovi nella curva di riproduzione dei conigli (serie di Fibonacci), o nelle armonie musicali. A sua volta il nostro orecchio contiene la coclea (credo che si chiami così), la cui forma a spirale risponde in pieno al rapporto 1,66. Come se l'Universo fosse stato costruito in base a una gigantesca armonia musicale, e il nostro orecchio sia stato costruito appositamente per percepirla.

Sarebbe davvero stupefacente, se invece tutto ciò fosse una semplice coincidenza.

(Mentre molti si affannano a trovare la "formula di Dio", a me ogni tanto viene il sospetto che la formula SIA Dio).

Citando infine il Vangelo di Tommaso: "Perchè vi preoccupate così tanto di sapere dove andrete a finire, quando non sapete nemmeno da dove venite?"

(Non ho risposto al tuo "punto per punto" per i motivi citati sopra, non perchè non ti abbia letto: finiremmo infatti per concordare che tu lo chiami "caos" e io lo chiamo in un altro modo. Ma le mele, appunto, continuano a cadere dagli alberi, e poi si decompongono. Non sono le molecole sparse sul terreno a COMPORSI in una mela).

Redazione
Inviato: 10/8/2007 15:11  Aggiornato: 10/8/2007 15:11
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
A chi dice che la teoria evoluzionistica non è stata demolita, ma soltanto riscritta, chiedo: dove, di grazia, la si potrebbe leggere?

olah
Inviato: 10/8/2007 15:29  Aggiornato: 10/8/2007 15:29
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
... l'angolo tra le foglie delle piante ...

Hai ragione Redazione, questo rapporto si trova ovunque.

L'embriogenesi è molto conservativa, sono poche le mutazioni non letali. Chissà se in altri pianeti si siano fissati gli stessi schemi, date per diverse le condizioni iniziali.

Anni fa ho letto un libro in cui Dio aveva messo un messaggio nel PI greco, ma per scoprirlo si doveva trovare una sequenza ordinata che si poteva capire solo dopo aver individuato un certo numero di cifre decimali. Dato che per trovare tale numero si doveva disporre di raffinate conoscenze matematiche e di computer molto potenti, forse pensava che l'Uomo dovesse leggere il messaggio solo dopo essersi evoluto a sufficienza.

Chissà se il tuo Demiurgo ha scritto un messaggio da qualche parte. Magari in una sequenza nucleotidica?

Redazione
Inviato: 10/8/2007 15:43  Aggiornato: 10/8/2007 15:49
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
OLAH : Citazione:
"Chissà se il tuo Demiurgo ha scritto un messaggio da qualche parte. Magari in una sequenza nucleotidica?"
Non so cosa sia un demiurgo ( ), ma mi pare che anche il DNA in qualche modo risponda alla sequenza di 1,66. E' per quello che dico "Dio E' la formula".

°°°

Citazione:
“Dato che per trovare tale numero si doveva disporre di raffinate conoscenze matematiche e di computer molto potenti, forse pensava che l'Uomo dovesse leggere il messaggio solo dopo essersi evoluto a sufficienza”.
Nella Bibbia – le cui origini non sono affatto ebraiche, btw – Mosè sale al monte per ricevere le leggi divine. Quando scende, però, si accorge che il suo popolo è tornato a venerare i simboli, per cui, incazzato, distrugge le tavole della Legge, le seppellisce alla base del monte, e al popolo rifila i Dieci Comandamenti, che starebbero alla vera Legge come l’Intrepido sta a Dante Alighieri.

Sull’altro fronte, ricordo un folgorante racconto di fantascienza (Asimov? Richardson?), nel quale gli umani si ingegnano per unire tutti i calcolatori della Terra, al fine di porre la Domanda Suprema: “Dio esiste?”

E la risposta fu: “Ora sì”.

mc
Inviato: 10/8/2007 15:53  Aggiornato: 10/8/2007 15:53
Sono certo di non sapere
Iscritto: 19/5/2004
Da:
Inviati: 7222
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
a me ogni tanto viene il sospetto che la formula SIA Dio


Si spiegherebbe anche la mia avversione per la matematica ...

mc

redna
Inviato: 10/8/2007 16:02  Aggiornato: 10/8/2007 16:02
Sono certo di non sapere
Iscritto: 4/4/2007
Da:
Inviati: 8095
 Re: Gli anelli mancanti continuano ad aumentare
cito-Si spiegherebbe anche la mia avversione per la matematica...
---
Dovresti avere anche avversione per la parola, il suono e il colore.

C’è al mondo una sola cosa peggiore del far parlare di sé: il non far parlare di se (Oscar Wilde)
shevek
Inviato: 10/8/2007 16:02  Aggiornato: 10/8/2007 16:02
Dubito ormai di tutto
Iscritto: 27/4/2005
Da: Napoli
Inviati: 1249
 Re: Gli anelli mancanti continuano ad aumentare
Salut y Libertad Massimo!


Dici:Citazione:
L’alternativa esiste, ed è molto semplice: siamo creature di una Entità superiore. Talmente superiore che con la nostra piccola mente non siamo in grado di comprenderne la logica, per cui affrontiamo il Problema applicando la nostra (vedi punto 2), con risultati decisamente penosi.


L'alternativa che proponi è innegabile, nel senso però che non possiamo né smentirla né dimostrarla. Dal punto di vista del rasoio di Occam, ha il difetto di introdurre un ente di troppo che, per di più, pone ulteriori problemi: come si è formato? Esiste da sempre? Coincide con l'Universo nella sua totalità o è trascendente ad esso? Se è trascendente perché ci avrebbe creati? Perché in quel momento del tempo e non un altro? Ecc.

Già sai, però, qual'è la mia obiezione principale alla questione: se si pone come difficoltà all'evoluzione la complessità dei fattori in gioco, tale obiezione vale in misura maggiore per la teoria di un "Intelligent Designer": i calcoli che occorrerebbero per un tale progetto sarebbero infiniti. Qui non è questione di una logica o di un'altra: un calcolo interminabile è un calcolo interminabile - per qualunque ente.

Per questo, insomma, resto "darwiniano": le obiezioni alla teoria dell'evoluzione basate sull'incompletezza di determinati resti fossili non tengono conto del fatto che la stragrande maggioranza dei resti biologici non si fossilizzano o, se lo fanno, vengono distrutti nel corso della storia. Il problema sarebbe se quelli che abbiamo a disposizione contraddicessero la teoria darwininiana in quanto tale: ma non è questo il caso, come è già stato fatto notare in questa discussione.


Shevek

"Il potere è l'immondizia nella storia degli umani" - F. Guccini
www.portadimassa.net - WEB-TV e non solo di Filosofia
olah
Inviato: 10/8/2007 16:07  Aggiornato: 10/8/2007 16:07
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Esistono più teorie sull'evoluzione. Molte sono raggruppabili come teorie neo-darwiniane.

Wikipedia ( http://it.wikipedia.org/wiki/Neodarwinismo ) cita alcuni nomi e le loro pubblicazioni: W. D. Hamilton, George C. Williams, John Maynard Smith, Richard Dawkins.

Le differenze tra le varie teorie riguardano più che altro i meccanismi dell'evoluzione.

Nel mio piccolo tanti tanti anni fa avevo aggiunto alle varie teorie un nuovo meccanismo: la fagocitosi. Avevo scoperto che se un'ameba subisce uno shock osmotico dopo essersi mangiata un batterio, un plasmide (una modecola di DNA circolare) può passare dal batterio al genoma di chi se lo mangia. Lo avevo dimostrato utilizzando un plasmide che, se si integrava, colorava le amebe di blu. Ma fui fortunato e sfortunato al contempo: il fenomeno era molto difficile da riprodurre e un esperimento non riproducibile non ha valore scientifico.

SENTIERO
Inviato: 10/8/2007 16:28  Aggiornato: 10/8/2007 16:28
Dubito ormai di tutto
Iscritto: 24/4/2006
Da: ROMA
Inviati: 1110
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:

Contraporre Evoluzionismo e Creazionismo come due teorie reciprocamente escludentesi è uno schema limitativo, che fa molto comodo ad ambedue le parti: siccome è molto facile dimostrare, dal fronte opposto, che ciascuna teoria non regge, si usa questa presunta “scelta obbligata” per dimostrare valida la propria teoria. In realtà, nessuno è in grado di sostenere che tertium non datur.


Le due teorie insieme, formano quella che definirei "la versione ufficiale" che viene offerta' all'umanita', al fine di impedirle di conoscere la verita'.

Togli una e cade automaticamente anche l'altra.

La mente intuitiva è un dono sacro e la mente razionale è un fedele
servo. Noi abbiamo creato una società che onora il servo e ha
dimenticato il dono

A.Einstein
Keevan
Inviato: 10/8/2007 16:42  Aggiornato: 10/8/2007 16:42
Ho qualche dubbio
Iscritto: 6/10/2005
Da:
Inviati: 126
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Sull’altro fronte, ricordo un folgorante racconto di fantascienza (Asimov? Richardson?), nel quale gli umani si ingegnano per unire tutti i calcolatori della Terra, al fine di porre la Domanda Suprema: “Dio esiste?”



era un racconto di Fredric Brown "La risposta"

La risposta

Wintermute
Inviato: 10/8/2007 16:54  Aggiornato: 10/8/2007 16:54
Dubito ormai di tutto
Iscritto: 11/1/2006
Da: aree riservate e protette
Inviati: 1096
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
L’alternativa esiste, ed è molto semplice: siamo creature di una Entità superiore. Talmente superiore che con la nostra piccola mente non siamo in grado di comprenderne la logica, per cui affrontiamo il Problema applicando la nostra (vedi punto 2), con risultati decisamente penosi.


Ottima risposta MMassimo!

per il resto però anc'io non posso che rimanere "darwinista":
se da un lato comprendo che ne darwin, ne chi per essi, abbia spiegato a sufficienza gli aspetti che legano Tempo e Vita, devo dire che è per ora l'unica teoria che (oltre che essere stata testata a fondo) che riesce a spiegarmi le basi del funzionamento dell'evoluzione.
e tanto basti.
Darwin non spiega ne perchè ne come sia iniziata la giostra, ma è riuscito a spiegare a grandi linee come funziona; poi ovvio, i dettagli più infimi del progetto non li sapremo mai (appunto, la nostra testa è troppo primitiva);
I creazionisti o i fanatici religiosi che predicano la creazione dal nulla, oltre che sminuire di gran lunga il lavoro stesso del Dio che vanno predicando (riducendolo ad un prestigiatore), non riescono a spiegare niente di tutto ciò che ci circonda
...senza considerare che darwin stesso era molto religioso, non si sarebbe mai azzardato a "inventare" una cosa "eretica"...

Citazione:
Sull’altro fronte, ricordo un folgorante racconto di fantascienza (Asimov? Richardson?), nel quale gli umani si ingegnano per unire tutti i calcolatori della Terra, al fine di porre la Domanda Suprema: “Dio esiste?”

E la risposta fu: “Ora sì”.

ti consiglio caldamente di guardarti la serie sperimentale serial experiments Lain, (sempre ammesso tu riesca a sopportalo)


Salvo il mondo...
ma con quale estensione?
olah
Inviato: 10/8/2007 17:06  Aggiornato: 10/8/2007 17:06
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Il demiurgo di Platone è un essere superiore che plasma il mondo materiale (non lo crea) usando la materia del mondo materiale e i modelli ideali del mondo delle idee.

Se il mondo fosse un software, direi che è un programmatore che utilizza i paradigmi della programmazione orientata agli oggetti.

ELFLACO
Inviato: 10/8/2007 17:32  Aggiornato: 10/8/2007 17:32
Dubito ormai di tutto
Iscritto: 28/10/2005
Da:
Inviati: 1839
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Anni fa ho letto un libro in cui Dio aveva messo un messaggio nel PI greco, ma per scoprirlo si doveva trovare una sequenza ordinata che si poteva capire solo dopo aver individuato un certo numero di cifre decimali. Dato che per trovare tale numero si doveva disporre di raffinate conoscenze matematiche e di computer molto potenti, forse pensava che l'Uomo dovesse leggere il messaggio solo dopo essersi evoluto a sufficienza.


Il libro ,se non mi ricordo male, è " Contact" di Carl Sagan
,come ex studente di astronomia è uno dei pochi libri che io abbia mai letto con tanto entusiasmo.

“Le persone non dovrebbero avere paura dei propri governi, sono i governi a dover aver paura delle persone.”
olah
Inviato: 10/8/2007 17:44  Aggiornato: 10/8/2007 17:44
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
-- citazione
Il libro ,se non mi ricordo male, è " Contact" di Carl Sagan

Esatto!

nottrz
Inviato: 10/8/2007 21:20  Aggiornato: 10/8/2007 21:20
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Purtoppo non riesco a leggere tutte le discussioni precedenti, ma mi piacerebbe comunque dire il mio punto di vista su un po' di aspetti.

Il primo e' quello degli anelli mancanti. Banalizzo. Supponiamo che affinche' un pesce diventi rettile servano due mutazioni favorevoli: zampe e polmoni. Quindi ho i miei bei pesci e ad un certo punto a uno spuntano le zampe, esce e muore. Poi ad un altro spuntano i polmoni, soffoca e schiatta. E cosi' via.
Finche' ad un certo punto, per condizioni particolari un pesce con le zampe riesce a riprodursi e, fortuna fortuna, al figlio spuntano pure i polmoni: evviva!
Che cosa troviamo pero' noi a livello di fossili? Un sacco di pesci e un sacco di rettili, semplicemente perche' la specie intermedia non ha raggiunto un numero elevato di esemplari cosi' da comparire nei fossili. Di fossili non ce ne sono moltissimi in giro e quindi sono rappresentativi soprattutto delle specie piu' numerose.
Per quale motivo le specie intermedie non dovrebbero essersi riprodotte molto? La mia opinione e' che si tratterebbe di specie poco specializzate, poco ottimizzate, un po' zoppe e quindi poco numerose. Inoltre, sempre per questo motivo su queste l'evoluzione avrebbe agito, senza volerlo, ancora piu' rapidamente (questo tema sarebbe da approfondire ma cerco di essere breve).

Rispetto al tema di questo articolo non credo che nessun ricercatore moderno sia particolarmente alla "semplicistica teoria lineare", credo che quella appunto sia buona per spiegare darwin ai bambini, ma gia' Darwin probabilmente vedeva la cosa in modo piu' articolato e da allora si sono riviste molte cose.
Che la situazione sia un po' piu' pasticciata non credo ci siano dubbi. La ricerca dell'albero evolutivo "classico" credo sia importante piu' da un punto di vista tassonomico che come strumento che spieghi le realta' specifiche del sud africa piuttosto che dell'australia.

Altro tema: casualita', mutazioni fortunate e intelligent design. Quando si cerca di screditare l'evoluzionismo, oltre naturalmente a rifarsi ad attaccarne una versione da scuole medie, si citano probabilita' e si cortocircuitano i ragionamenti in modo scorretto.
Faccio un esempio rifacendomi all'obiezione ai due fori che si trovano nel bacino citati in uno degli articoli suggeriti qui sopra. Noi adesso osserviamo una certa situazione e, a posteriori, riconosciamo delle "finalita'", ovvero quei buchi servono per. In realta' quelli sono due buchi e basta, nessuno dice che quello sia il loro "scopo". Concretizzo. Supponiamo ci sia stata una mutazione che abbia aperto quei due fori. E' una mutazione svantaggiosa? Diciamo di no, quindi me la posso tenere senza problemi. Molti anni dopo una seconda mutazione sposta i fasci nervosi dentro quei fori dandomi magari un effettivo vantaggio in mobilita'. E gia' questo secondo me bastarebbe.
In realta', secondo me, la situazione e' ancora piu' delicata: lo sviluppo del coprpo umano non e' a comparti stagni: una modifica a livello dello scheletro condiziona immediatamente la formazione di altre parti del corpo. Se ci si pone nelle primissime fasi dello sviluppo la presenza di quei fori puo' aver modificato i flussi sanguigni andando a condizionare lo sviluppo successivo.
Insomma, comunque la si veda la situazione e' un po' piu' articolata.
Su questo si aggiungono poi tutte le ricerche piu' recenti, nate da altri campi, come l'autoorganizzazione dei sistemi complessi, le nuove ricerche/ipotesi sulla passivita' dei processi di mutazione, ecc.

A proposito dell'intelligent design saro' brevissimo: e' una pseudo-teoria da un punto di vista "scientifico" completamente inconsistente. Non voglio dire se sia giusta o sbagliata, ma semplicemente che e' aria fritta, usa termini in modo inconsistente, usa in modo errato le teorie scientifiche su cui poggia, ecc. I dettagli li trovate nel libro unintelligent design che ho trovato molto convincente.
In questo libro c'e' anche una discussione molto bella sulle famose stime percentuali sugli eventi evolutivi, che si ottengono fondamentalmente ponendo vincoli extra problema.
Esempio: se voglio ottenere una molecola chimica formata da 10 pezzi tipicamente il calcolo viene fatto in modo assolutamente sequenziale, quando nulla mi impedisce che si siano formati prima 3 frammenti distinti da 3, 2 e 5 pezzi e che poi si siano uniti successivamente. Questo fa cambiare di molto i numeri.
Infine applicare il concetto di probabilita' ad un evento che si e' verificato una sola volta (l'evoluzione sulla terra) e' una cosa che va molto ai limiti del concetto di probabilita' e quindi va usato con molta molta cautela.

Scusate la lunghezza del post.

Redazione
Inviato: 10/8/2007 21:38  Aggiornato: 10/8/2007 21:43
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
la lunghezza del tuo post non è nulla rispetto a quella delle nostre passate discussioni.

E' per quello che ti garantisco che ciascuno degli aspetti che hai sollevato è stato rivoltato come uno guanto in ogni direzione, dozzine di volte.

Sull'intelligent design, alla fine una conclusione comune l'abbiamo trovata: che è una teoria più che altro inutile, in quanto l'intero essere vivente è una chiara manifestazione di intelligent design. Resta sempre aperta la questione del "progettista a priori" vs. "utilità a posteriori", ma che ogni essere vivente sia un chiaro "progetto intelligente" trovava tutti abbastanza d'accordo.

Tu infine dici che la "semplicistica teoria lineare è buona per spiegare darwin ai bambini". Il problema è che l'altra io non riesco a trovarla da nessuna parte.

Ho già posto la domanda a chi parla di "riscrittura e non di demolizione", ma ancora non ho avuto la risposta.

Polidoro
Inviato: 10/8/2007 23:36  Aggiornato: 10/8/2007 23:36
Mi sento vacillare
Iscritto: 9/4/2005
Da:
Inviati: 488
 Re: Gli anelli mancanti continuano ad aumentare
per Wintermute:

Un “Supercalcolatore” formato da tutti i computers di 96 bilioni di pianeti,
……….Sono presenti le somme autorità del consiglio galattico. Il progettista capo abbassa la leva che mette in funzione l'immensa struttura. Poi si rivolge al Presidente del Consiglio Galattico per offrirgli l'onore di porre la prima domanda al sistema. Il Presidente ci pensa un attimo, poi si rivolge alla macchina e chiede: “Dio, esiste ?” Dopo un attimo, arriva la risposta: “Sì, ADESSO” Il terrore si dipinge sulla faccia di tutti i presenti; il capo progettista si precipita verso il quadro di comando per bloccare la macchina. Ma un fulmine sceso dal cielo senza nubi lo incenerisce e fonde la leva di comando, inchiodandola per sempre al suo posto.

Fredric Brown (1906-1972) “La risposta” (1954)

Riflessioni su intelligent design, darwinismo,..:
http://priccio.blogspot.com/2007/07/quotes.html

L'idea di Dio, un essere onniscente, onnipotente, e che inoltre ci ama, è una delle più azzardate creazioni della letteratura fantastica.
(Jorge Luis Borges)

Io non so se Dio esiste, ma se non esiste ci fa una figura migliore.
(Stefano Benni)

Al principio fu creato l'Universo. Questo fatto ha sconcertato non poche persone ed è stato considerato dai più come una cattiva mossa.
(Douglas Adams)

Rendeteci gli dei del paganesimo. Adoreremo volentieri Giove, Ercole o Pallade, ma non vogliamo più saperne di quel fantomatico autore di un universo che si muove da solo, non vogliamo più saperne di un dio senza estensione che però riempie tutto della sua immensità, di un dio onnipotente che non esegue mai ciò che desidera, di un essere eccezionalmente buono che produce solo degli infelici, di un essere amico dell'ordine ma nel cui regno tutto è disordine. No, non vogliamo più saperne di un dio che disturba la natura, padre di confusione, che induce l'uomo ad abbandonarsi agli orrori; un dio simile ci fa fremere di indignazione e lo releghiamo per sempre nell'oblio da cui l'infame Robespierre ha voluto farlo uscire.
(D. A .F. De Sade)

Non meraviglia quindi la storiella molto diffusa nei paesi anglosassoni, soprattutto negli Stati Uniti, secondo la quale Gesù sarebbe stato un italiano: non solo infatti visse con la famiglia fino ai trent'anni, ma credeva che sua madre fosse vergine e che suo padre fosse addirittura un dio.
(Giordano Bruno Guerri, ANTISTORIA DEGLI ITALIANI)

E’ sbagliato giudicare un uomo dalle persone che frequenta. Giuda, per esempio, aveva degli amici irreprensibili.
(Marcello Marchesi)




Guardando le chemtrails o le Torri Gemelle che si disintegrano l'uomo moderno comprende che dietro tali fatti non può che esserci un "intelligent design".

D'altra parte se Darwin avesse conosciuto Bush o Prodi o..... avrebbe probabilmente rinnegato la sua teoria dell'evoluzione.

"Il vero viaggio di scoperta non consiste nel cercare nuovi orizzonti ma nell'avere nuovi occhi." Marcel Proust
nottrz
Inviato: 11/8/2007 0:26  Aggiornato: 11/8/2007 0:26
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Io con Intelligent design" mi riferisco strettamente a quanto sostenuto da Dembski, Behe e soci. Visto che c'e' chi propone di insegnarlo nelle scuole al posto di darwin, e in alcuni posti gia' succede, direi che non e' il caso di fargli pubblicita' occulta...

Sul fatto che gli esseri viventi siano frutto di "design intelligente" andrei di nuovo cauto, visto che siamo a dir poco parte del problema.
Non e' che il nostro concetto di intelligenza deriva proprio dall'osservazione di cio' che ci circonda? Oppure, non e' che noi riconosciamo attorno a noi solo cio' che si sposa con il nostro modo di ragionare?
Insomma, ci siamo dentro fino al collo, guardare le cose dal di fuori non e' facile.
Di certo non mi piace il termine, troppo antropocentrico e finalistico. I batteri sotto molti punti di vista sono un progetto molto piu' intelligente degli esseri viventi "superiori". Anche un fiume e' molto intelligente: porta l'acqua in basso con lo sforzo minimo possibile.
E se uno passa a dire che tutto l'universo e' molto intelligente si ritrova al punto di partenza: questo e' l'unico universo che conosciamo, con cosa possiamo confrontarlo? Siamo in grado di concepire un universo stupido? L'universo e' e non puo' non essere ;)

Per quanto riguarda la tua domanda facendo una ricerca al volo qui ho trovato un po' di spunti

http://www.anisn.it/scienza/evoluzione2005/problemi.htm

"Successivamente è stato scoperto che negli Eucarioti il DNA può venir modificato a livello dei geni regolatori (quelli cioè che hanno il compito di attivare o disattivare i veri e propri geni dall’ambiente) e nel 1991, su Annual review of genetics, sono stati descritti alcuni esperimenti che mettono in luce come in alcuni casi, soprattutto nelle piante, esiste un’influenza diretta dell’ambiente sul genotipo"

L'intero sito sembra ben fatto.
Qui per esempio

http://www.anisn.it/scienza/evoluzione2005/cespuglio.htm

" L’idea infondata dell’esistenza di un singolo ordine nella molteplice diversità della vita moderna deriva dalle nostre iconografie convenzionali e dai pregiudizi che le alimentano: la scala della vita e il cono della crescente diversità.[...]"

In un libro di stuart kauffman (se volete leggerne uno vi consiglio A casa nell'universo) citava alcune ricerche, mi pare sui linfociti, dalle quali si vede che inizialmente questi sono poco specilizzati nel contrastare un corpo esterno. A quel punto iniziano a riprodursi con un tasso di mutazioni molto alto fino a raggiungere forme via via piu' specializzate. La cosa piu' interessante, se gia' non bastasse questo "utilizzo esplicito" delle mutazioni, e' il fatto che la percentuale di mutazioni diminuisse col passare delle generazioni mano a mano che queste si specializzavano, come se la "sensibilita'" alle mutazioni potesse essere in qualche modo controllata.
(magari, fantasia mia, variando alcune caratteristiche fisico/chimiche del luogo in cui avviene la riproduzione cellulare la si puo' rendere piu' o meno "sicura").
Mi pare si parlasse di decine di generazioni, siamo cmq su scale temporali di pochi minuti, vado sempre a memoria.
Se vuoi vado a cercare il punto esatto, ma sarebbe un lavoraccio.

Anche questo sembra carino

http://www.terra.unimo.it/appunti/280.pdf

in particolare pagina 14, dove parla delle trasformazioni dei carapaci delle tartarughe. Chi ci dice che il carapace e sia meglio di quello a-b? Magari alla fine del giro si e' ritrovata con un guscio piu' pesante e meno robusto dell'altro. Sarebbe da indagare.
A pagina 8 si accenna al fatto che le mutazioni che possono avvenire sono vincolate dalla struttura complessiva dell'organismo (ovviamente possono avvenirne anche altre, ma l'organismo muore prima ancora di nascere). In questo senso a me non sembra improbabile che l'uomo x discenda da y ma che ad un certo punto abbia "invertito" una delle mutazioni subite dall'uomo x riscoprendo una caratteristica di un'antenato di x.

Nel libro investigations, sempre kauffman, si chiede se anche il meccanismo stesso di selezione naturale non sia soggetto a selezione e se si' perche' si sia stabilito questo e non altri. In altre parole parole che il meccanismo stesso di evoluzione, quale che sia, evolva a sua volta :)


Fammi sapere se un po' ho risposto alla tua domanda.


Nel frattempo pero' ho letto un po' degli altri thread e trovo che molte delle critiche che vengono mosse al darwinismo come fondamentali non siano poi cosi' forti. Molte si basano sulla presunta disponibilita' illimitata di fossili, che invece sono molto rari per gli animali superiori (poco tempo e poco resistenti). Di trilobiti ne trovi quanti ne vuoi e li' si possono vedere tutte le sfumature evolutive.
Il passaggio evolutivo da "scimmia" a "uomo" si ritiene sia avvenuto per neotenia cioe' la sospensione dello sviluppo del feto. In pratica un feto umano non e' altro che un feto di una "scimmia" nato con un paio di mesi di anticipo (vado a memoria). Questo tipo di mutazione altera di colpo diverse caratteristiche: forma della colonna vertebrale, ecc. e non lascia in giro forme intermedie.
Poi da li' si parte con i ritocchi.
E comunque di forme intermedie ce ne sono

http://www.devoniantimes.org/Order/re-tiktaalik.html
http://www.devoniantimes.org/Order/re-acanthostega.html

La rana con le corna da qualche parte ci sara' anche stata, ma le probabilita' che sia morta integra, ricoperta da una frana del tipo giusto e ritrovata da un paleontologo e', questa si', estremamente bassa.
E le speci di transizione, se si accetta la visione darwinista, hanno inevitabilmente una vita breve, in termini geologici, in quanto vengono scalzati dalle specie piu' specializzate a cui danno origine.

Non so, resto un po' perplesso.

sitchinite
Inviato: 11/8/2007 1:05  Aggiornato: 11/8/2007 1:05
Sono certo di non sapere
Iscritto: 3/6/2007
Da: Roma - Pomezia
Inviati: 3270
 Re: Gli anelli mancanti continuano ad aumentare
Vorrei intanto specificare una cosa x Wintermute e per Mario860... la teoria evoluzionistica non è affatto la migliore nè quella che spiega più cose, anzi....
e non è nemmeno così radicata nè un caposaldo....
la si difende ciecamente ma son sempre più coloro che se ne dissociano...

Non ricordo chi ha chiesto quali alternative ci sono... io son un seguace di quelle sostenute da Velikovsky, vonDaenicken, Sitchin, Hancock e Cayce.

Queste teorie spiegano molte più cose, sopratutto spiegano tutte le 'anomalie' che la scienza ufficiale non riesce a catalogare e quindi nega o nasconde...
Queste teorie in principio erano accettate anche da personaggi, allora meno famosi, che ora rinnegandole hanno raggiunto chiara fama (uno su tutti, la persona che disprezzo di più: Mark Lehner).

BRASA
Inviato: 11/8/2007 7:27  Aggiornato: 11/8/2007 7:27
Mi sento vacillare
Iscritto: 28/8/2005
Da: 1600 Pennsylvania Avenue NW Washington, DC 20500
Inviati: 442
 Re: Gli anelli mancanti continuano ad aumentare
dato che si è citato un libro, Contact, io suggerisco un film:
"Pi" il teorema del delirio.
bellissimo.

ispirazione e visione sono in se stesse il fine ed il risultato
Redazione
Inviato: 11/8/2007 9:17  Aggiornato: 11/8/2007 9:17
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
Nottrz: non ho capito a chi sia diretta la tua risposta, ma in ogni caso ti espongo brevemente la mia posizione (lo sapevo che alla fine ci cascavo).

Quando mi si dice che per formare la prima proteina è necessario che 238 (mi sembra) aminoacidi si dispongano DA SOLI in una certa sequenza, senza che UNO SOLO sia fuori posto, per me la teoria evoluzionistica ha già perso buona parte della sua credibilità.

Statisticamente parlando, siamo già ai limiti dell’impossibile. Se poi calcoli che questo è solo lì’inizio di una lunghissima catena di “coincidenze” altrettanto improbabili (mi pare che ci vogliano circa trenta proteine par fare una prima cellula semplicissima), il discorso è chiuso del tutto. Siamo già arrivati a n seguito da 40 zeri, se non ricordo male, e il DNA è ancora tutto da “inventare”.

Che esista l’evoluzione delle specie è fuori di dubbio, ma la teoria evoluzionistica come spiegazione della nostra presenza sulla Terra è statisticamente - e quindi scientificamente - inaccettabile.

shevek
Inviato: 11/8/2007 11:31  Aggiornato: 11/8/2007 11:31
Dubito ormai di tutto
Iscritto: 27/4/2005
Da: Napoli
Inviati: 1249
 Re: Gli anelli mancanti continuano ad aumentare
Salut y Libertad Massimo!


Il tuo ragionamento mi pare non tenga conto della cosiddetta "legge dei grandi numeri". In altri termini, è vero che le probabilità statistiche delle combinazioni "corrette" sono assai basse, ma il numero di interazioni atomiche e molecolari avvenute in miliardi di anni nell'intero pianeta terra è spaventosamente alto. Inoltre, qui stiamo parlando di molecole che, una volta createsi, hanno la capacità di autoreplicazione e di modificare l'ambiente circostante a favore della creazione di altre molecole simili.


Shevek

"Il potere è l'immondizia nella storia degli umani" - F. Guccini
www.portadimassa.net - WEB-TV e non solo di Filosofia
nottrz
Inviato: 11/8/2007 12:06  Aggiornato: 11/8/2007 12:06
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Ciao Massimo,
puoi indicarmi la fonte dei calcoli che citi? Sospetto che questi calcoli siano da studiare attentamente visto che in molti casi, ad esempio Dembski, sono semplicemente sbagliati o soprattutto malposti.

Faccio un'analogia: la formazione di una montagna e' un evento estremamente improbabile, richiede che tutti i pezzi di roccia vadano a collocarsi esattamente in quel modo, che guardacaso le rocce di un certo tipo restino piu' in basso e che lo strato di terra vada a collocarsi proprio sulla superficie e, come se non bastasse, che per caso, gli alberi vadano a spuntare esattamente come li vediamo noi. Quante probabilita' ci sono?

Nessuno sostiene che 238 aminoacidi si siano disposti tutti in fila una bella mattina. Una visione piu' ragionevole ipotizza che diversi frammenti si siano formati per conto loro, coppie, triplette di aminoacidi e cosi' via e che poi si siano agganciati tra loro in vari modi. La differenza tra 20! e 10! + 10! e' enorme (uso il fattoriale solo come esempio).
Ma soprattutto nessuno sostiene che il primo elemento chimico che abbia svolto quella funzione fosse proprio quella stessa proteina. E' possibile che in origine quella funzione fosse svolta in modo magari meno efficiente da 10 piccoli framenti distinti che nel tempo si sono legati tra loro e oggi riconosciamo come entita' unica.

Quello che in senso stretto sostengono i neodarwinisti e' che ad un certo punto si sia formato un ciclo autocatalitico, ovvero una sequenza di reazioni in grado di ripetersi, cioe' un circolo virtuoso di reazioni chimiche. E questa e' una cosa che si verifica praticamente sempre quando la varieta' chimica e' al di sopra di una certa soglia.
In pratica la mia molecola catalizza una reazione, che ne catalizza un'altra, ecc. che alla fine produce la molecola iniziale. Finche' la soluzione mantiene certe caratteristiche la reazione puo' ripetersi e le molecole che ne fanno parte prosperano.

Quale particolare ciclo si verifichi dipende dal composto, ma ce ne sono talmente tanti possibili che sistematicamente uno o piu' di uno compaiono e si mettono al lavoro. Alcuni cicli sono piu' rapidi di altri, alcuni piu' semplici altri meno. Non ci sono cicli preferenziali, essendoci una soluzione chimica complessa scaldata dal sole queste reazioni semplicemente avvengono, "utili" o "inutili" che siano.

Poi scoppia un temporale, altera la soluzione, e i cicli piu' fragili si rompono, altri resistono, altri si riorganizzano. Di fatto i cicli interagiscono tra loro: competono, collaborano, si creano forme di parassitismo, ecc.

Nel frattempo, solo grazie alle loro caratteristiche chimiche, altre molecole, per esempio simili ai moderni fosfolipidi, si dispongono a formare delle membrane intrappolando parte della soluzione. Alcune membrane saranno troppo chiuse e uccideranno quella reazione, altre entreranno a farne parte, magari catalizzandola o venendone catalizzate, formando un ciclo di reazioni piu' resistente ai cambiamenti esterni.
Magari inizialmente queste membrane sono solo fogli su cui le alcune molecole del mio ciclo, i principali catalizzatori, vanno ad ancorarsi. Solo in seguito, quando magari la corrente spinge il mio foglietto in una zona in cui sono presenti altri elementi chimici la membrana ri richiude.
Oppure, ma le due ipotesi non sono realmente alternative, il mio fosfolipide e' uno dei prodotti di scarto del mio ciclo iniziale, quindi la mia reazione si trova sempre circondata da queste molecole che per loro natura tendono a disporsi in modo ordinato. Di certo non a formare una splendida membrana sferica, magari le prime "cellule" erano una specie di spugna di fosfolipidi in cui erano nascosti i catalizzatori e solo poco alla volta gli agenti esterni la hanno frazionata in frammenti piu' piccoli autosufficienti.

Quello che ho descritto non e' una mia fantasia, ma quello che descrive ad esempio Dawkins nel primo capitolo del Gene Egoista, libro neodarwinista classico (alcuni esempi sono miei).

Queste cose si verificano nei programmi di simulazioni chimiche: data una sufficiente ricchezza di combinazioni e regole di interazione, quali che siano, compaiono dei cicli e alcuni di questi sono in grado di replicarsi. E la cosa non e' rara, ma praticamente inevitabile.

Aminoacidi, proteine, dna sono tutte cose che arrivano in seguito mano a mano che il ciclo si stabilizza e viene a contatto con nuove sostanze.
Supponiamo che la reazione A sia catalizzata dalle molecole x e y mentre la reazione B sia catalizzata da z. Adesso il mio ciclo viene a contatto con la molecola k che si unisca a z e catalizza la reazione A piu' rapidamente di x e y.
A quel punto mi ritrovo con la mia macromolecola kz che catalizza A e cosi' via.

Come mai trovo delle regolarita' cosi' nette come ad esempio nel dna? Perche' quando sviluppo un meccanismo (gruppo di molecole) particolarmente efficente questo prendera' il sopravvento sugli altri.
Supponiamo che nella mia protocellula ci fosse un protodna composto da due tipi differenti di "simboli" alcuni duplicati dal meccanismo A e gli altri dal B la cui velocita' sia doppia di A. La duplicazione delle molecole compatibili con B avvera' piu' rapidamente creando una standardizzazione. Il meccanismo A rimane attivo, ma diventa sempre meno indispensabile. E' possibile che qualche altra reazione inizi ad usarlo come pezzi di ricambio senza far morire la cellula e quindi scompare, o magari assume un'altra funzione e si resta stupiti dalla complessita' globale del ciclo che ha inglobato A.

Tornando all'analogia della montagna la natura non _voleva_ creare esattamente quella montagna, ma e' semplicemente venuta fuori quella tra le milioni di montagne possibili.
Se ho un sacchetto con dentro 1000 montagne possibili qual'e' la probabilita' di estrarre proprio quella? Naturalmente 1 su 1000. Ma qual'e' la probabilita' di estrarre una qualsiasi montagna tra quella possibili? Naturalmente il 100%. La natura non aveva preferenze in merito, non aveva quello come obiettivo, la sitazione attuale non era fissata a priori.
In questo senso il concetto di probabilita' e' molto delicato da usare.

Piccola nota: chi ci dice che i 238 aminoacidi siano disposti in modo cosi' perfetto? Che magari la maggior parte siano li' a far poco niente (o semplicemente da stabilizzatori per rendere piu' ridondata la struttura) e che alterandone una parte il comportamento complessivo cambierebbe di poco? Magari le proteine piu' antiche erano piu' grosse di quella moderne e magari esiste una versione a 100 aminoacidi che svolgerebbe la stessa funzione. Se si guarda alle simulazioni di reti booleane (kauffman) si trovano moltissime indicazioni in questo senso.

Io in tutto questo non vedo nessun passaggio a bassa probabilita', a meno che non si vincoli il modo in cui il processo si sia svolto cercando di linearizzare quello che e' un processo complesso, adattativo, opportunista assolutamente privo dei concetti di utilita' e finalita'.


P.S.
Mi resta il dubbio se i link che ti ho proposto nell'altro post e in questo possano essere considerati delle alternative alla "semplicistica teoria lineare buona per spiegare darwin ai bambini" oppure se queste restino ancora fantomatiche.

astro
Inviato: 11/8/2007 12:15  Aggiornato: 11/8/2007 12:15
Ho qualche dubbio
Iscritto: 3/6/2006
Da:
Inviati: 233
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Quando mi si dice che per formare la prima proteina è necessario che 238 (mi sembra) aminoacidi si dispongano DA SOLI in una certa sequenza,


A cosa ti stai riferendo, di preciso?

Citazione:
per me la teoria evoluzionistica ha già perso buona parte della sua credibilità.


e soprattutto, che arzigogolata relazione hai trovato tra quello che citi e la teoria evoluzionista?

L'evoluzionismo spiega l'evoluzione, non la comparsa della vita.

Anonimo
Inviato: 11/8/2007 14:08  Aggiornato: 11/8/2007 14:11
 Re: Gli anelli mancanti continuano ad aumentare
Vorrei intervenire sul "discorso proteico".

Come dice nottrz è troppo semplicistico partire dal risultato per dire "no le probabiltià sono troppo basse perché ciò possa essere avvenuto".

Proprio dalla biochimica arrivano prove dell'evoluzione.

Se prendiamo l'omoglobina per esempio, non è vero che la sequenza degli aminoacidi sia identica in ogni individuo.

Ogni individuo ha la sua bella emoglobina mutata.

I punti salienti in una proteina sono numerabili.

Rimanendo sull'emoglobina,l'istidina distale (E7) aumenta l'affinità di legame tra il Ferro e l'ossigeno, svavorendo il legame con l'anidride carbonica.

Naturalmente un individuo che nasce con un altro aminoacido al posto di quell'istidina, muore.

Come dicevo ci sono altri punti chiave nella catena, e mutazioni in quei punti portano al non funzionamento dell'emoglobina, ma non tutta la sequenza è fissa.

Anche perché l'emoglobina è ancora in evoluzione visto che non è ancora "abile" al 100% nel fare il suo lavoro.

E su questo l'evoluzione gioca, esistono individui che hanno un emoglobina più performante, e questo si traduce in una migliore performance fisica, che in una società primitiva significava maggiori possibilità di sopravvivenza.

Ma il discorso di nottrz è compatibile con quello che diceva Massimo sull'armonia di base.

Tutto cresce e si evolve secondo un rapporto universale e la spiegazione sta proprio nei processi che ha indicato nottrz.

Ogni passo successivo è diretta conseguenza di quello precedende, e a quello si conforma.

Se "invento" il metro, tutto poi sarà misurato in metri, questa sarà la base su cui si fonderà tuto quel che viene dopo.

Se le interazioni tra gli aminoaicidi devono sottostare a determinate leggi chimiche, naturalmente tutte le stutture che ne deriveranno avranno quei cardini geometrici.

Vi ricordo che gli aminoacidi che il nostro corpo usa come "mattoni per le proteine" sono solo 20.

Il perché si sono "scelti" solo quelli levogiri a discapito di quelli destrogiri, non è dato sapere, ma così è.

Un po' come la distanza tra i binari, così era e così è, perché cambiare?

Sitentizzando, è vero che c'è un'armonia universale, una matrice unica, e senza difficoltà la si può chiamare dio (io la chiamo "magia", ma è solo un'etichetta).

Ma il rapporto causa effetto è invertito.

Basta impiantare un seme di armonia perché tutto si evolva secondo quello schema, perché i mattoni base quelli sono e di lì non si può scappare.

Non è il tutto che man mano si conforma a quell'armonia.

olah
Inviato: 11/8/2007 15:20  Aggiornato: 11/8/2007 15:20
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
-citazione-
Quando mi si dice che per formare la prima proteina è necessario che 238 (mi sembra) aminoacidi si dispongano DA SOLI in una certa sequenza, senza che UNO SOLO sia fuori posto, per me la teoria evoluzionistica ha già perso buona parte della sua credibilità.

Statisticamente parlando, siamo già ai limiti dell’impossibile. Se poi calcoli che questo è solo lì’inizio di una lunghissima catena di “coincidenze” altrettanto improbabili (mi pare che ci vogliano circa trenta proteine par fare una prima cellula semplicissima), il discorso è chiuso del tutto. Siamo già arrivati a n seguito da 40 zeri, se non ricordo male, e il DNA è ancora tutto da “inventare”.


Redazione, non so dove hai preso queste informazioni ma, scusami l'espressione, sono campate per aria.

Perché la prima proteina dovrebbe aver avuto 238 aminoacidi e chi ha stabilito quale dovesse essere la sua sequenza primaria? Perché non un polipeptide da 15 aa.? E poi sequenze proteiche differenti possono assumere forme simili e svolgere funzioni analoghe...

Chi ha stabilito poi che la cellula primordiale dovesse contenere delle proteine? Come si è stabilito il numero di trenta? E se la prima molecola di DNA fosse stata sintetizzata da ribozimi?

Non possiamo sapere come fosse fatta la prima cellula, non abbiamo indizi. Al limite possiamo fare delle ipotesi e delle simulazioni.

Polimeri organici di varia natura si possono formare anche senza l'intervento di un essere vivente. Questi polimeri si possono avvolgere su se stessi formando le strutture tridimensionali termodinamicamente più stabili. Alcune di queste forme possono comprendere tasche che contengono gruppi chimicamente attivi i quali, in presenza di reagenti, catalizzano una reazione chimica: si formano gli enzimi.

Un enzima può essere una proteina, una molecola di RNA, o un altro tipo di polimero. Una molecola di RNA può aver assunto la capacità di autoreplicarsi. Tale molecola, se circondata da una membrana lipidica, ad esempio durante la formazione di un emulsione, può partecipare alla formazione di una pseudo-cellula.

Ma queste sono solo speculazioni, potremmo immaginare moltissimi scenari possibili senza azzeccare quello giusto.

Ad ogni modo non possiamo escludere matematicamente la possibilità che, in tempi geologici, una miscela di acqua e molecole organiche di varia natura non possa dare origine a entità viventi. Anzi, mi sembrerebbe strano se un universo caotico come il nostro non desse origine spontaneamente a forme di vita, data la sua tendenza alla complessità: basta osservare la formazione di un cristallo per rendersi conto del fatto che ci troviamo in un ambiente che genera entropia (disordine) creando forme strutturalmente organizzate e complesse (ordine).

andal
Inviato: 11/8/2007 22:07  Aggiornato: 11/8/2007 22:07
Ho qualche dubbio
Iscritto: 4/10/2006
Da:
Inviati: 58
 Re: Gli anelli mancanti continuano ad aumentare
ciao a tutti,

permettete una domanda (stupida)

i fossili di animali che sono stati trovati al mondo e che risalgono a 25 milioni di anni fa e corrispondono ad animali ancora viventi nella nostra epoca cosa sono ? animali che hanno perso il treno della evoluzione ?

Redazione
Inviato: 11/8/2007 22:31  Aggiornato: 11/8/2007 22:31
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
Lo sapevo, lo sapevo,...... va bene, me la sono cercata. Vado a recuperare il tutto.

Redazione
Inviato: 11/8/2007 22:44  Aggiornato: 11/8/2007 22:46
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
Eccomi. Non trovo però la discussione originale, quella "lunga". Qualcuno della redazione mi sa segnalare dove è stata spostata?

°°°

Le proteine sfidano il caso

Il fallimento della teoria evoluzionista si rivela non soltanto in riferimento alla cellula, ma anche ai suoi elementi costitutivi, qualora tenti di offrire una spiegazione plausibile. La formazione, in condizioni naturali, di soltanto una singola proteina tra le migliaia di molecole complesse che costituiscono la cellula, è impossibile.

Le proteine sono molecole giganti che consistono di unità più piccole dette "amminoacidi", i quali vengono disposti secondo una sequenza particolare in certe quantità e strutture. Queste molecole costituiscono i blocchi da costruzione delle cellule viventi. La più semplice è composta di cinquanta amminoacidi, mentre in altre se ne possono contare migliaia.

Il punto cruciale è che l'assenza, l'aggiunta o la sostituzione di un singolo amminoacido nella struttura di una proteina può trasformarla in un inutile ammasso molecolare. Ogni amminoacido deve trovarsi al posto giusto e nell'ordine corretto. La teoria evolutiva, che sostiene la casuale manifestazione della vita, dispera di fronte a questo ordine troppo meraviglioso per poter essere spiegato con la coincidenza. (La teoria non è inoltre in grado di giustificare la presunta "formazione casuale" degli amminoacidi, di cui discuteremo oltre.)

Il fatto che la struttura funzionale delle proteine non possa assolutamente essersi presentata per caso può facilmente essere osservato per mezzo del semplice calcolo delle probabilità, comprensibile a tutti.

Una proteina di media dimensione è composta di 288 amminoacidi, dei quali esistono dodici tipi differenti. Questi possono essere disposti in 10300 modi diversi. (Questo numero astronomicamente grande consiste di un 1 seguito da 300 zeri.) Di tutte queste possibili sequenze, soltanto una forma la desiderata molecola proteica. Il resto di esse sono catene di amminoacidi che possono risultare o del tutto inutili o potenzialmente dannose per gli esseri viventi.

In altre parole, la probabilità della formazione di una sola molecola proteica è pari a "1 su 10300". La probabilità che questo "1" accada è praticamente impossibile. (In matematica, le probabilità inferiori a 1 su 1050 sono considerate "probabilità zero").

Per di più una molecola proteica di 288 amminoacidi è piuttosto modesta se paragonata ad alcune molecole proteiche giganti composte di migliaia di amminoacidi. Qualora si applichi il calcolo delle probabilità a queste proteine giganti, la parola "impossibile" diventa inadeguata.

Avanzando di un passo nella direzione dello schema dello sviluppo della vita, osserviamo che una sola proteina non significa nulla per se stessa. Uno dei più piccoli batteri mai scoperti, il Mycoplasma Hominis H39, contiene 600 tipi di proteine. In questo caso dovremmo ripetere gli stessi calcoli delle probabilità prima applicati ad una sola proteina per ognuno di questi 600 tipi differenti. Il risultato rende assurdo anche il concetto stesso di impossibilità.

Alcuni lettori che considerino la teoria dell'evoluzione una spiegazione scientifica, potrebbero sospettare che questi numeri siano esagerati e che non riflettano i fatti: questi sono dati definiti e concreti. Nessun evoluzionista potrebbe muovere alcuna obiezione a questi numeri, i quali confermano la probabilità che la formazione accidentale di una singola proteina "sia pari alla possibilità che una scimmia scriva la storia dell'umanità su una macchina da scrivere senza commettere alcun errore".93 Nondimeno, piuttosto di accettare l'altra spiegazione, che è la creazione, essi continuano a difendere quanto è manifestamente impossibile.

Molti evoluzionisti lo hanno confessato. Ad esempio, Harold F. Blum, un noto scienziato evoluzionista, il quale afferma che "la formazione spontanea di un polipeptide delle dimensioni della più piccola proteina nota è al di là di ogni probabilità."94

Gli evoluzionisti affermano che l'evoluzione molecolare sia avvenuta nel corso di un periodo molto lungo di tempo che ha reso possibile l'impossibile. Nondimeno, indifferentemente dalla durata, gli amminoacidi non possono formare delle proteine in modo accidentale. William Stokes, un geologo americano, nel suo libro Essential of Earth History scrive che tale possibilità è così remota "che essa (la proteina) non sarebbe potuta apparire neppure nel corso di miliardi di anni su miliardi di pianeti, ognuno dei quali ricoperto da un manto di soluzione di acqua concentrata dei necessari amminoacidi."95

Cosa significa tutto questo? Perry Reeves, professore di chimica, risponde a questa domanda:

Quando si esamina il vasto numero di strutture possibili che potrebbero risultare da una semplice combinazione casuale di amminoacidi in un primordiale stagno in evaporazione, è stupefacente credere che la vita possa avere avuto origine in questo modo. È più plausibile che un Gran Costruttore con un progetto maestro sia necessario a una tale impresa.96

Se la formazione accidentale di anche una sola di queste proteine è impossibile, è miliardi di volte ancora più impossibile che circa un milione di queste proteine si riuniscano in modo corretto casualmente e costituiscano una cellula umana. Ciò che è più importante, una cellula non è mai composta di un mero ammasso di proteine. Oltre a queste, una cellula include anche gli acidi nucleici, i carboidrati, i lipidi, le vitamine e molte altre sostanze chimiche quali gli elettroliti, ordinate in proporzioni specifiche, in armonia e ordine, sia in termini di struttura che di funzione. Ognuna di queste funge da blocco abitativo o co-molecola in vari organuli. Robert Shapiro, professore di chimica preso l'Università di New York e esperto di DNA, ha calcolato la probabilità di formazione accidentale dei 2000 tipi di proteine trovati in un singolo batterio (Vi sono 20000 differenti tipi di proteine in una cellula umana). Il numero che si ottenne fu 1 su 1040000.97 (Questo è un numero incredibile, che si ottiene aggiungendo 40000 zeri all'1.)

Un professore di matematica applicata e astronomia presso la University College (Cardiff, Galles), Chandra Wickramasinghe, commenta:

La probabilità di una formazione spontanea della vita dalla materia inanimata è pari a 1 seguito da 40000 zeri... È abbastanza grande da seppellire Darwin e l'intera teoria dell'evoluzione. Non vi è stato alcun brodo ancestrale, né su questo pianeta né su qualsiasi altro, e se gli inizi della vita non furono accidentali, allora devono essere stati prodotti da un'intelligenza risoluta.98

Sir Fred Hoyle scrive a proposito di questi numeri non plausibili:

In verità, tale teoria (che la vita sia stata creata da un'intelligenza) è così ovvia che ci si stupisce che non sia ampiamente accettata come evidente. Le ragioni sono psicologiche piuttosto che scientifiche.99

La ragione per cui Hoyle ha usato il termine "psicologico" è l'auto-condizionamento degli evoluzionisti a non accettare il fatto che la vita possa essere stata creata. Queste persone hanno deciso di rifiutare l'esistenza di Allah come loro obiettivo principale. Soltanto per questo motivo, perseverano a difendere gli irragionevoli scenari che essi stessi riconoscono come impossibili.


Proteine sinistrorse

Esaminiamo ora in dettaglio la ragione per cui lo scenario evoluzionista relativo alla formazione di proteine è impossibile.

La corretta sequenza di amminoacidi non è del tutto sufficiente alla formazione di una molecola proteica. Oltre a questo, ognuno dei venti tipi differenti di amminoacidi presenti nella composizione di proteine deve essere levogiro. Esistono due tipi differenti di amminoacidi detti "levogiri" e "destrogiri". Ciò che li differenzia è la simmetria speculare tra le loro strutture tridimensionali, che è simile alla mano sinistra e alla mano destra di una persona.

Questi due tipi di amminoacidi possono essere facilmente collegati tra loro. La ricerca ha rivelato un fatto sorprendente: tutte le proteine nelle piante e negli animali, dall'organismo più semplice a quello più complesso, sono costituite da amminoacidi levogiri. Se anche un solo amminoacido destrogiro si fissasse alla struttura di una proteina, essa diverrebbe inutilizzabile. In alcuni esperimenti, i batteri ai quali furono dati amminoacidi destrogiri immediatamente li distrussero e in alcuni casi formarono degli amminoacidi levogiri dai componenti spezzati in modo da potersene servire.

Supponiamo, per un istante, che la vita pervenga all'esistenza casualmente, come sostengono gli evoluzionisti. In questo caso, gli amminoacidi destrogiri e levogiri che fossero in tal modo generati, dovrebbero essere presenti schematicamente in parti uguali in natura. Tutti gli esseri viventi, quindi, dovrebbero essere costituiti da aminoacidi destrogiri e levogiri, in quanto è chimicamente possibile che entrambi i tipi si combinino reciprocamente. In realtà, le proteine esistenti in ogni organismo vivente sono costituite soltanto da amminoacidi levogiri.

Come le proteine possano scegliere soltanto i levogiri tra tutti gli amminoacidi, mentre neppure un destrogiro possa essere compreso nel processo vitale, è una questione ancora irrisolta da parte degli evoluzionisti, i quali non possono spiegare una selezione talmente specifica e conscia.

Questa caratteristica delle proteine intensifica, inoltre, la confusione dell'impasse "coincidentale" degli evoluzionisti. Affinchè una proteina "significativa" venga generata, non è sufficiente che gli amminoacidi siano in un numero determinato, in una sequenza perfetta e combinati insieme secondo la corretta forma tridimensionale, devono anche essere selezionati soltanto tra i levogiri e neppure un destrogiro può essere presente. Non esiste, tuttavia, alcun meccanismo di selezione naturale che comprenda che un amminoacido destrogiro è stato aggiunto alla catena e che debba quindi essere rimosso in quanto erroneo. Questa situazione inficia ancora una volta la possibilità della coincidenza e del caso.

Nella Britannica Science Encyclopaedia, strenua paladina dell'evoluzionismo, si dice che gli amminoacidi di tutti gli organismi viventi sulla terra e i blocchi di polimeri complessi quali le proteine hanno la stessa asimmetria sinistra. Viene aggiunto, inoltre, che questo è equivalente a lanciare una moneta mille volte e a ottenere sempre "testa". Si ammette inoltre che non è possibile comprendere perché le molecole divengano sinistrorse o destrorse e che tale alternativa è fascinosamente correlata all'origine della vita sulla terra.100

Se si ottiene sempre testa gettando una moneta un milione di volte, è più logico attribuirlo al caso o accettare che vi sia un intervento consapevole? La risposta dovrebbe essere ovvia. Nondimeno, a dispetto della sua apparente evidenza, gli evoluzionisti si rifugiano nella coincidenza semplicemente perché non vogliono accettare l'esistenza di un "intervento consapevole".

Una situazione simile si presenta con i nucleotidi, le più piccole unità del DNA e del RNA. Al contrario degli amminoacidi negli organismi viventi, sono scelte solo le forme destrorse di nucleotidi. Anche questa situazione non potrà mai essere spiegata per mezzo della coincidenza.

Per concludere, è definitivamente provato dalle probabiltà che abbiamo esaminato in precedenza che il caso non può spiegare l'origine della vita. Se tentiamo di calcolare la probabilità di una media proteina composta di 400 amminoacidi, selezionati soltanto tra i levogiri, otteniamo la probabilità di 1 su 2400, che corrisponde a 10120. Solo per fare un confronto, è utile ricordare che il numero di elettroni nell'universo è stimato pari a 1079, che è assai inferiore a questo numero. La probabilità degli amminoacidi che formano la sequenza richiesta e la forma funzionale determinerebbe numeri molto superiori. Se congiungiamo queste probabilità e ampliamo il soggetto alla formazione di un più elevato numero e tipo di proteine, il calcolo diventa inconcepibile.

---

http://www.islamforweb.net/inganno%20evoluzione.htm

andal
Inviato: 11/8/2007 22:56  Aggiornato: 11/8/2007 22:56
Ho qualche dubbio
Iscritto: 4/10/2006
Da:
Inviati: 58
 Re: Gli anelli mancanti continuano ad aumentare
alcuni link


il sito di Harun Yahya di cui trattato l'articolo postato da Massimo prima


il museo dei fossili

Redazione
Inviato: 11/8/2007 23:01  Aggiornato: 11/8/2007 23:15
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
NOTTRZ: Scusami, non ero poi andato a vedere i tuoi link. Lo faccio al più presto.

ASTRO: "L'evoluzionismo spiega l'evoluzione, non la comparsa della vita."

In America il confronto Evoluzionismo-Creazionismo affronta chiaramente il problema della comparsa della vita. In ogni caso, basta che ci mettiamo d'accordo sui termini. Dimmi tu come chiamare quella teoria che spiega la vita grazie ad una serie di mutazioni genetiche casuali, e senza intervento divino, nè design pre-esistente, e useremo quel termine.

Redazione
Inviato: 11/8/2007 23:11  Aggiornato: 11/8/2007 23:16
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
NOTTRZ: Ho dato un’occhiata – confesso veloce – ma sufficiente a capire che quelle sono pagine sull’evoluzione delle specie, e non sull’evoluzionismo come spiegazione della comparsa della vita senza un’intervento esterno.

Quello che io non ho mai trovato - e questa sì l’ho cercata a fondo, ai tempi - è una descrizione dettagliata (e quindi credibile) della lunghissima lista delle combinazioni prima, e mutazioni casuali poi, che ci avrebbero portato dalla prima proteina, appunto, a Leonardo da Vinci.

Si fa in fretta a dire "e poi venne il DNA".

Che l’evoluzione delle specie sia una realtà innegabile l’ho già detto più di una volta. Non sono nè cieco nè dogmatico (nè soprattutto religioso). Il problema è che per me non basta a spiegare la nostra PRESENZA sulla Terra, e a dirmelo è la scienza statistica (vedi sopra).

Oldboy
Inviato: 11/8/2007 23:18  Aggiornato: 11/8/2007 23:33
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Harun Yahya è un ottimo divulgatore scientifico: i suoi scritti sono altamente consigliabili.

Una delle sue argomentazioni più efficaci è questa (cito a memoria):

L'evoluzionista è un tizio che, vedendo una pila di mattoni in mezzo al deserto, pensa:
"Il puro caso ha fatto sì che l'argilla del terreno circostante si unisse a formare - in migliaia e migliaia di anni - un mattone.
Un mattone a forma di perfetto parallelepipedo, senza alcuna irregolarità.
Dopo altre migliaia di anni, un altro mattone identico al primo si è formato, in modo altrettanto casuale.
Quando alcuni mattoni si sono formati, infine, il vento li ha collocati (sempre per puro caso) l'uno sopra l'altro, come oggi li vediamo..."

E' chiaro che tutti noi prenderemmo per matto chiunque "ragionasse" (diciamo così) in questa bislacca maniera.

Ma il punto è che ogni singola cellula è immensamente più complessa di una pila di mattoni.
La cellula è stata paragonata dagli studiosi a una grande astronave.
Un'astronave così complessa che siamo ancora ben lontani - nonostante tutti i progressi della scienza - dal conoscerla a fondo.

Ma l'evoluzionista "ragiona" così: questa astronave in miniatura si è formata per puro caso, a partire da materia inorganica, in milioni di anni.
Poi molte astronavi si sono unite, ecc...
(E vissero tutti felici e contenti... ).

astro
Inviato: 12/8/2007 0:29  Aggiornato: 12/8/2007 0:29
Ho qualche dubbio
Iscritto: 3/6/2006
Da:
Inviati: 233
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
In America il confronto Evoluzionismo-Creazionismo affronta chiaramente il problema della comparsa della vita. In ogni caso, basta che ci mettiamo d'accordo sui termini. Dimmi tu come chiamare quella teoria che spiega la vita grazie ad una serie di mutazioni genetiche casuali, e senza intervento divino, nè design pre-esistente, e useremo quel termine.


Suppongo che per "spiega la vita" intendi "spiega l'origine della vita".

Se è così è un dibattito sul nulla, in quanto si confronta una teoria non scientifica contro una non teoria (al più un ipotesi). E' metafisica e niente di più.*

Mi chiedi come chiamare la teoria che spiega l'origine della comparsa della vita. Semplice:
non c'è una teoria scientifica che spiega la comparsa della vita. Tutto qui. Altrimenti avremmo una teoria che indirettamente dimostra la non esistenza di dio... qualcosa di sconvolgente, non trovi?

L'evoluzionismo, o neodarwinismo, spiega la varietà della vita, arrivando a postulare un progenitore comune a tutte le forme di vita, ma nulla dice su questo progenitore.
Non per niente l'evoluzionismo è accettato da molte religioni (compresa la cristiana cattolica).

Chi attacca l'evoluzionismo attaccando la non spiegazione dell'origine della vita compie quella fallacia che tu chiameresti "uomo di paglia". Ne più ne meno.


---

*Metafisica che può anche piacere, ma si premetta che si sta discutendo di filosofia e teologia e non di scienza.

L'assoluta non scientificità con cui viene trattato l'argomento è evidente a chiunque abbia una minima alfabetizzazione in scienze biologiche.
Ad esempio la conformazione L degli amminoacidi, portata come suggestiva prova dietrologica...

le conformazioni L e D per le molecole di interesse biochimico sono delle pure convenzioni non correlate ad alcuna proprietà chimica: si prende come riferimento la gliceraldeide e si paragonano ai sostituenti del carbonio asimmetrico più distante da quello che lega il gruppo carbonilico, se hanno similitudine con la D-gliceraldeide verrà nominato D e viceversa.
D e L nella gliceralceide indicano il potere rotatorio che il gruppo ha sulla luce polarizzata.

I 20 aminoacidi canonici hanno potere rotatorio sia orario che antiorario, nessuna particolarità chimico-fisica nella loro chiralità.

Chiedersi perchè le cellule sintetizzino ed utilizzino proprio questi enantiomeri e non gli altri equivale a chiedersi perchè vengono usati proprio quei 20 aminoacidi, o proprio quelle basi puriniche e pirimidiniche ...

(ho stringato il discorso e mi rendo conto che non è immediatamente comprensibile a chi non abbia i rudimenti di chimica, ma spero che renda l'idea che spappardellare una nozione senza averla compresa induce a errori grossolani)

Polidoro
Inviato: 12/8/2007 0:59  Aggiornato: 12/8/2007 0:59
Mi sento vacillare
Iscritto: 9/4/2005
Da:
Inviati: 488
 Re: Gli anelli mancanti continuano ad aumentare
Io lavoro in una Biblioteca e mesi fa è arrivato gratuitamente un enorme libro che, forse (ora sono in ferie e non posso controllare), è questo Harun Yahya. Enorme, carta ottima, una quantità impressionante di illustrazioni di alta qualità: il meglio del meglio. Stampato all’estero (Turchia ? non ricordo)

Gratis.

In questo caso rifletti che lo stesso libro è stato mandato a tutte le biblioteche e che il costo dell’operazione è enorme.
Per cui ti domandi: chi finanzia una cosa del genere ?
Ovviamente per farlo deve possedere mezzi economici straordinari, no ? Un mecenate, uno dei tanti benefattori di cui l’umanità abbonda ?

Se poi faccio ricerca in, per esempio, IBS.it bookshop, scopro che il bel librone NON è in vendita: strano no ?
Non solo ma degli immumerevoli libri scritti dall’autore, secondo quanto detto nel suo sito, non ne è in vendita alcuno !

Altre sue opere includono: Il Nuovo Ordine Massonico, Massoneria e Capitalismo, La “mano segreta” in Bosnia, Dietro le quinte del terrorismo, La carta curda di Israele, Strategia nazionale per la Turchia, L’ostilità di Darwin nei confronti dei Turchi, Nazioni rovinate, Per uomini dotati di intelletto, Il miracolo nella cellula, Il miracolo nell’occhio, Il miracolo nel ragno, Il miracolo nel moscerino, Il miracolo nella formica, Il miracolo del sistema immunitario, Attraverso la ragione si scopre Allah, Atemporalità e realtà del destino, La verità della vita in questo mondo.

Fra i suoi opuscoli: Il crollo della teoria evoluzionista: la realtà della creazione, Il crollo del materialismo, La fine del materialismo, Gli errori degli evoluzionisti I, Gli errori degli evoluzionisti II, Gli errori scientifici nei testi per le scuole pubbliche, Il crollo microbiologico dell’evoluzione, La realtà della creazione, Il mistero dell’atomo, Il crollo dell’evoluzione in venti domande, Il più grande inganno nella storia della scienza: il darwinismo

Altre opere dello stesso autore riguardanti il Corano: Hai mai pensato alla verità?, Devoto di Allah, Abbandonare la società dell’ignoranza, Il Paradiso, Valori morali nel Corano, Conoscenza del Corano, Indice del Corano, Emigrare per la causa di Allah, Gli ipocriti nel Corano, I segreti dell’ipocrita, Gli epiteti di Allah, Comunicazione del Messaggio e discussione nel Corano, Concetti basilari nel Corano, Risposte dal Corano, Morte resurrezione e Inferno, L’impegno dei Profeti, Il nemico dichiarato dell’uomo: Satana, L’idolatria, L’arroganza di Satana, La preghiera nel Corano, La coscienza nel Corano, Il giorno della Resurrezione, Non dimenticare mai, Insegnamenti del Corano trascurati, La religione degli ignoranti.


Quest’uomo, dall’aspetto giovanile e prestante, dove ha trovato il tempo per scrivere tutta questa roba ?

E il libro è scritto bene e illustrato benissimo, estremamente suggestivo. Suggestivo.

E così si creano le due fazioni, evoluzionisti e creazionisti.

Ora che la Fusione Fredda esista è stato dimostrato (tra l’altro dal CNR) innumerevoli volte.
Se la Fusione Fredda esiste (ma è occultata evidentemente) essa rivoluziona enormemente la Fisica e dimostra che non sappiamo abbastanza per decidere tra molecole, caso e “intelligent design”.
No, non quando siamo così ciechi da non vedere che la gallina, privata di calcio ma fornita di mica muscovite, trasforma tranquillamente quest’ultima in calcio per fare il guscio alle sue uova.
Cioè la gallina sa fare molto più che noi: una reazione nucleare a temperatura ambiente !

E’ lei, la gallina, che sa se siamo tutti usciti dal Caos o dall’”Intelligent Design”o da …

"Il vero viaggio di scoperta non consiste nel cercare nuovi orizzonti ma nell'avere nuovi occhi." Marcel Proust
Al2012
Inviato: 12/8/2007 1:49  Aggiornato: 12/8/2007 1:49
Dubito ormai di tutto
Iscritto: 25/10/2005
Da:
Inviati: 2158
 Re: Gli anelli mancanti continuano ad aumentare
Mi sento in sintonia con il pensiero di Massimo, è sono sempre più convinto, che nel fenomeno vita la casualità centri molto poco.

Penso che ci sia un errore di base nella teoria evoluzionistica legata al caso ed alla selezione naturale, e sia quello di considerare la vita come un insieme di cose separate, ognuna con una propria evoluzione biologica.

Penso che sia anche errato pensare ad un creatore della vita, a meno che non li si faccia coincidere, Creatore = Vita = Coscienza Infinita.

Noi possiamo cercare di comprendere il quale tempo e in che forma si è manifestata la vita sulla terra, che tipo di evoluzione ha permesso la creazione di organismi complessi, sempre più complessi e sempre più coscienti, ma questo non potrebbe mai spiegare il “fenomeno vita” “la Magia della Vita”.

Domandina della buona notte !!

E’ la materia , in forma organica complessa, che genera la coscienza, ovvero la coscienza è un fenomeno casuale che si può manifestare in organismi complessi o è vero il contrario, che sia la coscienza a creare la materia, o per meglio dire, ad assemblare la materia in modo da evolvere in un organismo complesso in grado di ricevere e trasmettere coscienza ??

Quel fenomeno “Magico della Vita” a cui partecipiamo, potrebbe essere più che una evoluzione biologica una evoluzione di coscienza / pensiero??

“Capire … significa trasformare quello che è"
Anonimo
Inviato: 12/8/2007 6:02  Aggiornato: 12/8/2007 6:07
 Re: Gli anelli mancanti continuano ad aumentare
Massimo, forse hai saltato a piè pari il mio commento, ma le proteine non devono essere identiche in ogni amminoacido.

Basta solo che gli amminoacidi chiave siano quelli, gli altri possono mutare senza grossi problemi, anzi , possono pure favorire il miglior funzionamento della proteina in questione.

Ti ho portato l'esempio dell'emoglobina apposta.

Redazione
Inviato: 12/8/2007 7:59  Aggiornato: 12/8/2007 8:12
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
MORFEO: Io non faccio il chimico, e non è a me che devi dare certe spiegazioni tecniche. Se tu ritieni che quanto dici sia sufficiente a confutare per intero le critiche all'evoluzionismo che ho postato più sopra, ben per te.

La stessa risposta vale naturalmente anche per ASTRO.

A me è piaciuto molto l'esempio dei mattoni e delle case, ma sperare che possa comprenderlo chi ragiona "con mente scientifica" - visto che è proprio quel modo di ragionare che vuole criticare - è una pura illusione.

In ogni caso, mi sono stati chiesti i dati da cui ho tratto quanto affermavo, e li ho postati (sbagliando, fra l'altro, per difetto: ho detto 40 zeri, quando erano QUARANTAMILA!) Ma non ho nessuna intenzione di mettermi a discutere sul singolo aminoacido, quando la dimensione della improbabilità di una sequenza vitale, dallo stagno primordiale a Leonardo, è così mostruosa che solo chi non vuole riesce a non vederla.

Un pò come Attivissimo, che cerca di farti discutere sui centimetri del buco nel Pentagono, quando abbiamo ai comandi dell'aereo un imbranato totale che non sa nemmeno come funziona un'automobile, non parla una parola di inglese, e non ha mai guidato prima un jet nella sua vita.

Sorry, the big picture FIRST.

°°°

AL2012: la seconda che hai detto, ovviamente. E' mille volte più sensata della teoria "scientifica" che vuola la materia acquisire un giorno la coscienza, un pò come al mattino si compera il giornale. Come ho già detto, si fa in fretta a dire "e poi venne il DNA".

Polidoro
Inviato: 12/8/2007 10:18  Aggiornato: 12/8/2007 10:18
Mi sento vacillare
Iscritto: 9/4/2005
Da:
Inviati: 488
 Re: Gli anelli mancanti continuano ad aumentare
Adnan Oktar nom de plume Harun Yahya ……
http://en.wikipedia.org/wiki/Adnan_Oktar
The Atlas of Creation
His latest (October 2006) publication is The Atlas of Creation, published by Global Publishing, Istanbul, Turkey.[26] The book is edited by Timothy Mossman, with no indication to his affiliation. This volume with near 800 glossy pages contains high quality animal and fossil image prints. Many of the photographs were obtained without the permission of copyright holders, a violation that will likely prevent the release of this book on the mainstream market. Tens of thousands of copies of the book have been delivered, on an unsolicited basis, to schools, prominent researchers and research institutes throughout Europe and the United States [27][3]. E.g. several schools in France have received a copy as well as prominent researchers at Utrecht University in the Netherlands, and the Imperial College London, where the arguments used by the book to undermine evolution have been criticized as not logical while evolutionary biologist Kevin Padian has stated that Oktar has no understanding of the basic evidence for evolution.[28][3]. When the book was sent to French schools and universities, controversy resulted and the book sparked further concern about Islamic radicalism in France.[3]

The large cost of the printing and shipping of the book indicates that Oktar has some large source of outside funding, but at present what that source is remains a mystery. [3]

[3] Cornelia Dean. "Islamic Creationist and a Book Sent Round the World", New York Times, July 17, 2007. Retrieved on July 17, 2007.

Questa è una lettera che conferma la storia: http://www.cobraf.com/forumf/topic.asp?topic_id=4739

le (strane?) allenze: petrodollari e creazionisti

"E´ stato consegnato a tutti gli insegnanti di scienze e di filosofia dei Licei Scientifici un lussuoso volume di circa 800 pagine, ricco di documentazione fossile, proveniente dall´Ungheria ma stampato ad Ankara, dal titolo L´ATLANTE DELLA CREZIONE, corredato dal CD "I fossili hanno screditato l´evoluzione". Finanziato da creazionisti islamici, pare con il supporto di quelli americani, il libro è molto diffuso in Turchia e ora inizia a esserlo in vari paesi europei. L´autore, tale Adnar Oktar, scrive con il nome di Harun Yahya. Il testo intende "smascherare l´impostura degli evoluzionisti, invalidare le loro pretese, rivelare gli oscuri legami tra darwinismo e ideologie sanguinarie come il fascismo e il comunismo". La novità è che il riferimento non è più la Bibbia ma il Corano, unica fonte di sentimenti di amore universale contrapposti alla violenza.
Un librone gigantesco, riccamente illustrato, ben tradotto in italiano. Un libro con pagine quasi A3, alto come due guide telefoniche, colorato e rifinito come le miniature medievali, ti arriva a casa gratis: gli editori hanno soldi a palate. Pare sia tradotto in cinquantadue (52) lingue. Insomma si tratta di una grandissima campagna di comunicazione del creazionismo islamico."

L'autore ha ^una storia interessante http://en.wikipedia.org/wiki/Adnan_Oktar

Riassumo:
nell'86 scrive "ebraismo e massoneria"; li accusa di voler erodere i valori religiosi e morali dei turchi
nel '90 fonda la bav (fondazione per la ricerca scientifica) che nel '96 distribuisce il suo libro "la bugia dell'olocausto"
adesso non ce l'ha più con gli ebrei, ma ha messo nel mirino l'evoluzionismo.

il mondo dunque è un po' più complicato di come ce lo gabellano i vari neocon: io continuo a vederlo attraversato da una faglia che divide il pensiero religioso da quello scientifico e i veri nemici sono pericolosamente mischiati.




Che ne dici Massimo ?

"Il vero viaggio di scoperta non consiste nel cercare nuovi orizzonti ma nell'avere nuovi occhi." Marcel Proust
astro
Inviato: 12/8/2007 10:47  Aggiornato: 12/8/2007 10:47
Ho qualche dubbio
Iscritto: 3/6/2006
Da:
Inviati: 233
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
MORFEO: Io non faccio il chimico, e non è a me che devi dare certe spiegazioni tecniche. Se tu ritieni che quanto dici sia sufficiente a confutare per intero le critiche all'evoluzionismo che ho postato più sopra, ben per te.

La stessa risposta vale naturalmente anche per ASTRO.

A me è piaciuto molto l'esempio dei mattoni e delle case, ma sperare che possa comprenderlo chi ragiona "con mente scientifica" - visto che è proprio quel modo di ragionare che vuole criticare - è una pura illusione.

In ogni caso, mi sono stati chiesti i dati da cui ho tratto quanto affermavo, e li ho postati (sbagliando, fra l'altro, per difetto: ho detto 40 zeri, quando erano QUARANTAMILA!) Ma non ho nessuna intenzione di mettermi a discutere sul singolo aminoacido, quando la dimensione della improbabilità di una sequenza vitale, dallo stagno primordiale a Leonardo, è così mostruosa che solo chi non vuole riesce a non vederla.

Un pò come Attivissimo, che cerca di farti discutere sui centimetri del buco nel Pentagono, quando abbiamo ai comandi dell'aereo un imbranato totale che non sa nemmeno come funziona un'automobile, non parla una parola di inglese, e non ha mai guidato prima un jet nella sua vita.

Sorry, the big picture FIRST.


Quanti spunti di discussione in poche righe

Questa risposta non la sento molto appropriata a quello che ho scritto, dove il punto cruciale era l'assenza di una teoria che spiega l'origine della vita e non l'esempio in coda al post. Se avessi voluto discutere dei dettagli il mio post sarebbe stato una sequela di citazioni seguite da "scorretto", "impreciso" etc...

Torniamo alla tua risposta...

Il quadro generale qual'è? Che l'origine della vita è assai misteriosa?
Non mi pare una grossa novità.

Che una soluzione (metafisica) al dilemma è l'introduzione di un Creatore?
Anche qui non mi pare una grossa novità.

Insomma, stiamo discutendo di cose che si discute da 5000 anni circa, con la differenza che si introducono concetti che normalmente non sono compresi appieno da chi li porta.
Un po' come i tuoni e Zeus....

La "mentalità scientifica" (che probabilmente contesti senza conoscere) non è contrapposta all'idea di Dio (nè di nessun'altra idea) a priori, ma risponde esclusivamente a quel metodo tanto caro al Galilei.
Nessuno finora è in grado di replicare o di osservare la "formazione della vita" (con o senza intervento del Creatore). Ne consegue che di scientifico nella discussione c'è ben poco, e ognuno può credere (e non sostenere) quel che vuole.

Oltre l'origine della vita c'è l'evoluzione. Son due discorsi ben distinti, anche se può sembrare ovvio spingersi a chiedersi cosa c'era prima ancora.
Contrariamente a quanto sostengono molti "creazionisti" - è possibile osservare l'evoluzione continuamente, il modello neodarwinista funziona e finora non è emerso nulla che lo metta seriamente in crisi. Scoperte come quelle che citi nell'articolo riguardano più i tassonomisti che gli evoluzionisti.

L'esempio dei mattoni ha ben poco a che fare sia con la presunta "mentalità scientifica" sia con l'evoluzione in sè. Ma sperare che possa capirlo chi ragiona con...


-

In conclusione vorrei tornare sul "big picture".

Se uno scrive un cumulo di stronzate un insieme di inesattezze e con queste tratteggia un grande disegno, poi non può aver la pretesa di sdoganare le sue erronee premesse solo perchè il disegno, nel suo insieme, è così bello.

Lo trovo un modo di ragionare del tutto campato in aria.
Si può giungere a conclusioni corrette solo partendo da premesse corrette e non sperare "d'averci preso" solo perchè le conclusioni a cui si è arrivati sono in qualche modo suggestive.

Se le premesse non possono essere poste in discussione si chiamano "assiomi", ma vanno bene solo in matematica. Altrimenti prendono nome di dogmi, e funzionano alla grande in metafisica.

Pausania
Inviato: 12/8/2007 10:49  Aggiornato: 12/8/2007 10:49
Sono certo di non sapere
Iscritto: 6/4/2006
Da:
Inviati: 3872
 Re: Gli anelli mancanti continuano ad aumentare
Riporto dal sito di Kelebek (lettura quotidiana mooolto consigliata):

IL DONATORE MISTERIOSO

[Il] clamoroso caso Harun Yahya: per chi non lo sapesse, un misterioso signore che usa questo nom de plume, e di cui i nostri giornalisti sembrano non sapere nulla, ha spedito dalla Turchia migliaia e migliaia di copie in omaggio di un libro - l'Atlante della Creazione - di quasi ottocento pagine, su carta patinata e con bellissime illustrazioni, ad altrettanti destinatari in mezza Europa e poi in Italia: giornalisti, intellettuali e semplici insegnanti.

Il libro è un attacco diretto alla teoria dell'evoluzione, da un punto di vista dichiaratamente creazionista. [...]

Il testo, invece, sottolinea due punti.

[...] L'abolizione del darwinismo, eliminando tutti questi mali, introdurrà ciò che lui chiama "l'età dell'oro", di pace tra popoli, religioni e classi sociali.

[...] La creazione [...] non sarebbe altro che una sorta di proiezione cinematografica, ricca di illusioni, che Dio offre alle nostre menti: la materia quindi non esiste.

[...]

l'organizzazione di Adnan Oktar - il vero nome, per nulla segreto, di Harun Yahya - gestisce centinaia di siti web con pagine che vanno dall'italiano al hausa, passando per il tedesco e l'uzbeko; produce filmati molto elaborati nelle stesse lingue; e organizza conferenze in decine di città del mondo, in particolare - ma non solo - all'interno di comunità e istituzioni islamiche. Muove schiere di avvocati e abili professionisti in ogni settore, in grado di rispondere immediatamente a ogni attacco: persone con una perfetta cultura internazionale e mediatica.

[...]

Harun Yahya, maestro del religiosamente corretto, invoca in ogni momento un fronte unito di cristiani, ebrei e musulmani.

[...]

E' lo stesso programma dei teocon statunitensi, che invocano un fronte cattogiudaicoevangelico contro gli stessi mali.

[...]

come gli evangelici americani, Harun Yahya invita a ritornare al Libro, per ottenere la salvezza personale.

Nel suo caso, il libro è il Corano; ma lo stile con cui lancia l'appello, e i mezzi che adopera, la struttura dei suoi filmati, il suo stesso abbigliamento, ricordano molto da vicino i telepredicatori americani.



L'ARRIVO DEGLI ISLAMOCAPITALISTI

Harun Yahya organizza convegni a Istanbul con l'Institute for Creation Research (ICR) dei fondamentalisti (nel senso corretto del termine) statunitensi [...]

Ma la faccenda è più complessa.

I creazionisti statunitensi si sono scissi tra i letteralisti biblici dell'ICR e un nuovo organismo, assai più astuto, il Discovery Institute, che ha lanciato l'idea più vaga di "disegno intelligente", fatta proprio da molti ambienti cattolici e lanciata in Italia dal Foglio di Giuliano Ferrara. A differenza del monotematico ICR, il Discovery Institute è molto vicino alla macchina della destra politica negli Stati Uniti.

E infatti, questa spaccatura si riflette in Turchia, dove accanto a Harun Yahya, vicino all'ICR e politicamente non filostatunitense, troviamo Mustafa Akyol , un suo ex-seguace, più sofisticato nei modi, che ha lanciato l'Akıllı Tasarım Teorisi - "la teoria del disegno intelligente" - mentre, su tutti i peggiori organi della néconnarderie statunitense, scrive saggi in difesa dell'"islamocapitalismo", a favore dell'alleanza con gli Stati Uniti e di critica alla politica del governo verso i curdi.

Il teoconismo non è certo un'esclusiva cristiana.



Poi dando una sbirciata alle teorie di questo personaggio:

L'INGANNO DELL'EVOLUZIONE

La realtà è chiara ed evidente. Tutta la vita è il prodotto di un progetto perfetto e di una creazione superiore. Questo offre una prova concreta dell'esistenza di un Creatore, Colui Che detiene un potere, un'intelligenza e una conoscenza infiniti.

Il Creatore è Dio, il Signore dei cieli e della Terra e di tutto ciò che è tra loro.

andal
Inviato: 12/8/2007 10:51  Aggiornato: 12/8/2007 10:51
Ho qualche dubbio
Iscritto: 4/10/2006
Da:
Inviati: 58
 Re: Gli anelli mancanti continuano ad aumentare
nel Corano, ci sono molte prove del creazionismo,

molti scienziati hanno ammesso la straordinaria presenza di fatti scientifici che l'uomo è riuscito a scoprire negli ultimi anni, dal big bang agli stadi di sviluppo del embrione..

Pausania
Inviato: 12/8/2007 11:05  Aggiornato: 12/8/2007 11:05
Sono certo di non sapere
Iscritto: 6/4/2006
Da:
Inviati: 3872
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
nel Corano, ci sono molte prove del creazionismo

Certo, e aggiungerei che ci sono molte prove dell'esistenza di Dio...

nottrz
Inviato: 12/8/2007 11:12  Aggiornato: 12/8/2007 11:44
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Al2012: Penso che ci sia un errore di base nella teoria evoluzionistica legata al caso ed alla selezione naturale, e sia quello di considerare la vita come un insieme di cose separate, ognuna con una propria evoluzione biologica.

Scusa la schiettezza, ma questa idea dove l'hai letta? Nessuno sostiene questo.

Secondo me la debolezza delle piu' note critiche all'evoluzionismo e' proprio imporre questo tipo di approccio strutturato/sequenziale/ordinato. In pratica, per dirla chiara, si crea un finto bersaglio facile da demolire (e di queste cose siamo tutti esperti dal 911...)

Per costruire una casa ci sono due modi: scavare le fondamenta e procedere un piano allo volta. L'uomo lavora cosi', la natura no.

Quando un albero si sviluppa non vengono prima le radici e poi il tronco, un centrimentro alla volta salendo, e coi' via. Prima viene creata una piccola copia del risultato finale e poi la si va a raffinare/completare poco alla volta.
Questo e' il procedimento che usa la natura per produrre un po' tutto quanto, fiumi, organismi, ecc.
Io ritengo utilizzi lo stesso approccio nel caso dell'evoluzione.

La casa evoluzionistica verrebbe costruita cosi': prima due rami incrociati, poi si aggiunge qualche rinforzo qua e la, poi la si ricopre di un qualche materiale piu' solido, a quel punto i rami iniziali si trovano, meraviglia, a svolgere la funzione di struttura portante, ecc. Poi dopo tot tempo la struttura esterna viene modellata dal vento ed assume una forma perfettamente conica, ecc.
Poi il peso la fa sprofondare nel terreno e, meraviglia, si creano le fondamenta. Quando arrivo sulla spiaggia corro subito a cercare l'ingegniere.
Ovviamente e' solo un'analogia.

Se si vuole criticare l'evoluzionismo critichiamo quello e non delle veriazioni sul tema.

Aggiunta:

astro: Mi chiedi come chiamare la teoria che spiega l'origine della comparsa della vita. Semplice:
non c'è una teoria scientifica che spiega la comparsa della vita. Tutto qui. Altrimenti avremmo una teoria che indirettamente dimostra la non esistenza di dio... qualcosa di sconvolgente, non trovi?

Non ci sara' La Teoria, ma ci sono diverse ricerche in merito e molte sono legate all'evoluzionismo. Anche perche' penso sia legittimo chiedere ripetutamente all'evoluzionista: e prima di quello cosa c'era? Dove ci si ferma? Ai batteri? Ai frammenti di rna?
Nell'interpretazione della vita come emergenza spontanea c'e' continuita' tra i due discorsi.

Per quanto riguarda dio quello poi lo si riesce sempre a cacciare dentro dappertutto. Se anche si arrivasse ad una spiegazione materialistica della comparsa della vita si potrebbe sempre dire che dietro c'e' stata la mano di dio, stile intelligent design. Nessuna teoria scientifica potra', per definizione, mai provare la non esistenza di dio.



Oldboy: L'evoluzionista è un tizio che, vedendo una pila di mattoni in mezzo al deserto, pensa:
"Il puro caso ha fatto sì che l'argilla del terreno circostante si unisse a formare - in migliaia e migliaia di anni - un mattone.
Un mattone a forma di perfetto parallelepipedo, senza alcuna irregolarità.
Dopo altre migliaia di anni, un altro mattone identico al primo si è formato, in modo altrettanto casuale.
Quando alcuni mattoni si sono formati, infine, il vento li ha collocati (sempre per puro caso) l'uno sopra l'altro, come oggi li vediamo..."

A me sembra chiaro come questa sia solo un'analogia e non appena la si analizza con attenzione i suoi limiti diventano evidenti.
Il grosso errore di fondo e' sempre il solito: vincolare _a priori_ l'obiettivo quando la natura non aveva quell'obiettivo.

Il mattone non si e' formato per "puro caso", ma si e' formato per cause. Il caso in senso stretto non esiste: chiamiamo caso una serie di cause che non riusciamo a riconoscere/distinguere*. Il concetto di "puro caso" e' vuoto.

Perche' ci appare "artificiale" trovare dei mattoni sulla spiaggia? Perche' sono differenti da tutto cio' che viene prodotto dalla natura.
Invece non troviamo strano che i cristalli abbiano una struttura incredibilmente regolare, che le bolle di sapone siano sfere quasi perfette, che i sassi di un fiume siano levigati perfettamente, ecc.

Inoltre il processo di formazion che viene descritto e' forzatamente surreale. Un evoluzionista se proprio dovesse provare a spiegarlo direbbe che prima e' caduto dal cielo un blocco di argilla, che il calore del del sole la ha cotta e sempre il calore la ha spezzata in piu' parti lungo delle linee regolari gia' presenti nel blocco o create dall'evaporazione dell'acqua, ecc.
E' chiaro che questa che ho descritto non e' una spiagazone ma solo un esercizio per chiarire cosa non va nell'esempio riportato.



* Lasciamo da parte le differenti _interpretazioni_ di alcuni eventi quantistici e restiamo sul macroscopico.

nottrz
Inviato: 12/8/2007 12:04  Aggiornato: 12/8/2007 12:04
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
andal , bella domanda. Mi puoi citare qualche esempio? Sono proprio uguali uguali? Non sono domande retoriche, e' giusto per avere dei riferimenti da cui partire.

Se fossero degli animali antichi (es. gasteropidi marini) mi verrebbe da dire che visto che sono in giro da un sacco di anni e che probabilmente il loro ambiente non e' cambiato poi molto e' possibile che non abbiano avuto la necessita'/possibilita' di evolversi oltre in modo significativo.

Tutti i processi di ottimizzazzione lavorano molto bene all'inizio, ma piu' si fanno progressi piu' diventa difficile progredire.

Come per l'atleta di salto in alto diventa sempre piu' difficile guadagnare quel centimetro in piu' mano a mano che diventa bravo.

Inoltre, praticamente sempre, ci si trova intrappolati in quelli che vengono chiamati ottimi locali, cioe' nel nostro caso le basi strutturali dell'organismo vincolano sempre di piu' le direzioni in cui l'organismo puo' progredire.
Se 300mila anni hanno ottimizzato per bene il guscio della mia bestiola e' difficile che una breve esplorazione delle alternative trovi soluzioni migliori.
E' possibile che esistano, ma richiedono ripensare tutto il "progetto" dall'inizio.

olah
Inviato: 12/8/2007 12:25  Aggiornato: 12/8/2007 12:52
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Harun Yahya farebbe bene a ripassarsi un po' di biochimica prima di scrivere certi articoli... A parte questo, a mio parere commette almeno tre errori grossolani:

Primo errore: considera solo il prodotto finito ignorando il processo. Mi spiego con un esempio:

immaginiamo un algoritmo semplice semplice (si può anche non leggere, serve solo per dire che è di poche righe)

For each pixel on the screen do:
{
x = x0 = x co-ordinate of pixel
y = y0 = y co-ordinate of pixel

iteration = 0
maxiteration = 1000

while ( x*x + y*y < (2*2) AND iteration < maxiteration )
{

xtemp = x*x - y*y + x0
y = 2*x*y + y0

x = xtemp

iteration = iteration + 1
}

if ( iteration == maxiteration )
colour = black
else
colour = iteration
}


Questo algoritmo di poche righe disegna un insieme di Mandelbrot, una figura decisamente complessa. Un esempio in questo filmato:

http://www.youtube.com/watch?v=gEw8xpb1aRA

Ora, qual'è la probabilità di disegnare a caso una figura del genere? Bassissima. Eppure è il prodotto di un algoritmo semplice. Nessuno immaginava che la reiterazione di una formula così banale potesse dare origine a figure frattali, però è successo.

Che senso ha dire: la proteina è troppo complessa per essersi relizzata per caso?

E' possibile che, in una scala temporale sufficientemente ampia, una combinazione casuale di elementi semplici possa dare origine, in modo deterministico, a una proteina? Questa è la domanda e non si può rispondere con un calcolo statistico, perché non ci sono statistiche. L'unico modo per rispondere se è possibile (non se è avvenuto) è la simulazione al calcolatore, o al limite un dialogo con il Creatore. Inutile tentare calcoli probabilistici.

Secondo errore: nel fare il calcolo delle probabilità, già di per sé inutile, non tiene conto del numero di casi favorevoli.

In un universo infinito, o in un universo finito che fa parte di un insieme di universi infinito, la probabilità che da qualche parte in qualche tempo si verifichi un qualunque evento possibile è tendente a 1, perché il numero dei casi favorevoli è tendente a infinito.

Yahya è in grado di stabilire che esiste un numero finito di pianeti e che questo numero è talmente piccolo da giustificare il suo calcolo probabilistico?

Terzo errore: non ha studiato. Il suo articolo contiene troppi strafalcioni per essere preso sul serio: Alcuni esempi:

Citazione:
Le proteine sono molecole giganti che consistono di unità più piccole dette "amminoacidi", i quali vengono disposti secondo una sequenza particolare in certe quantità e strutture. Queste molecole costituiscono i blocchi da costruzione delle cellule viventi.


Troppo riduttivo, sono una parte importante ma ci sono molti altri tipi di molecole altrettanto importanti. In teoria si può immaginare una proto-cellula senza proteine.

Citazione:
Una proteina di media dimensione è composta di 288 amminoacidi, dei quali esistono dodici tipi differenti. Questi possono essere disposti in 10300 modi diversi. (Questo numero astronomicamente grande consiste di un 1 seguito da 300 zeri.) Di tutte queste possibili sequenze, soltanto una forma la desiderata molecola proteica.


Le proteine sono modulari, hanno dei domini, la cui sequenza può non essere determinata in modo rigido.

Esempio: un dominio transmembrana può essere fatto da una sequenza variabile di amminoacidi idrofobi. Attaccato al dominio transmembrana, all'esterno della cellula può esserci un recettore che può contenere sequenze ipervariabili (anticopri, recettori virali...). All'interno della cellula ci può essere un dominio con una manciata di aminoacidi che rappresentano il gruppo attivo (quello che catalizza una reazione chimica), il resto serve a creare la tasca che ospita il gruppo attivo.

Proteine diverse possono utilizzare gli stessi domini. Spesso i domini hanno un'origine comune.

La conseguenza delle mutazioni dipendono dagli aminoacidi che mutano. In molti casi le conseguenze sono nulle, in altri casi la proteina perde la sua funzione, in altri ancora acquisisce una funzione.
Il nostro sistema immunitario funziona grazie alle sequenze ipervariabili degli anticorpi, l'immunità è il prodotto di una selezione naturale, produciamo tutte le combinazioni possibili e selezioniamo quelle che si associano alle molecole aliene.
Un virus può passare da un uccello all'uomo quando i suoi recettori acquisiscono, per mutazione, la capacità di agganciare le cellule umane. Spesso avviene nei maiali che hanno sia i recettori degli uccelli sia i recettori dei mammiferi. Anche questo è un processo di selezione naturale.

Citazione:
Avanzando di un passo nella direzione dello schema dello sviluppo della vita, osserviamo che una sola proteina non significa nulla per se stessa. Uno dei più piccoli batteri mai scoperti, il Mycoplasma Hominis H39, contiene 600 tipi di proteine. In questo caso dovremmo ripetere gli stessi calcoli delle probabilità prima applicati ad una sola proteina per ognuno di questi 600 tipi differenti. Il risultato rende assurdo anche il concetto stesso di impossibilità.


Quante di quelle 600 proteine hanno un'origine comune? Quante hanno dei domini in comune? Quante derivano dalla trascrizione di un unico gene oppure da modifiche post-traduzionali della stessa proto-proteina?

Yahya sembra ignorare una serie di concetti fondamentali, quali la ricombinazione. Gli organismi viventi non re-inventano continuamente le stesse strutture. Se un dominio idrolasico funziona, sarà conservato e lo ritroveremo in diverse proteine, magari con piccole variazioni e specializzazioni. Le proteine sono modulari e i geni ricombinano.

Citazione:
Il fatto che la struttura funzionale delle proteine non possa assolutamente essersi presentata per caso può facilmente essere osservato per mezzo del semplice calcolo delle probabilità, comprensibile a tutti.


Di che proteina sta parlando: un citocromo, un recettore, il citosceletro, un capello?

La prima proteina poteva benissimo essere un semplice polipeptide idrofobico con la funzione di filamento trans-membrana, magari per collegare strutture interne ed esterne di una cellula.
Successivamente la parte interna può aver avuto alcuni aminoacidi in grado di promuovere l'idrolisi di alcune molecole ed essersi conservato e perfezionato col tempo, creando i primi enzimi...

Che ne sa Yahya di quanto potesse essere semplice o complessa la prima proteina e quanti aminoacidi dovesse avere per fare dei calcoli probabilistici? Come fa a valutare l'evoluzione delle proteine partendo dalle strutture attuali e non da quelle primordiali, per di più facendo una pseudo-analisi statistica (senza dati statistici)?

astro
Inviato: 12/8/2007 12:35  Aggiornato: 12/8/2007 12:35
Ho qualche dubbio
Iscritto: 3/6/2006
Da:
Inviati: 233
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
astro: Mi chiedi come chiamare la teoria che spiega l'origine della comparsa della vita. Semplice:
non c'è una teoria scientifica che spiega la comparsa della vita. Tutto qui. Altrimenti avremmo una teoria che indirettamente dimostra la non esistenza di dio... qualcosa di sconvolgente, non trovi?

Non ci sara' La Teoria, ma ci sono diverse ricerche in merito e molte sono legate all'evoluzionismo. Anche perche' penso sia legittimo chiedere ripetutamente all'evoluzionista: e prima di quello cosa c'era? Dove ci si ferma? Ai batteri? Ai frammenti di rna?
Nell'interpretazione della vita come emergenza spontanea c'e' continuita' tra i due discorsi.



Ci sono diverse ipotesi (materialiste, non è superfluo specificarlo dato il contesto) sull'origine della vita. E in un certo senso anche alcune ricerche.
Ma non c'è alcun modello che la teorizzi.

Se restiamo a livello di ipotesi, ognuno sceglie la sua preferita.
Tra aminoacidi piovuti dalle comete, ribozimi factotum e il Creatore, allo stato attuale c'è poca differenza (beh, aminoacidi su precipitati cosmici sono stati ritrovati, i ribozimi sono una realtà, solo sul creatore mancano evidenze, ma questa è un'altra storia)

C'è continuità tra evoluzione e origine della vita a livello concettuale. Ma il compito della teoria neodarwinista è quello di spiegare la varietà della vita, non l'origine.

E' lecito chiedere ad un evoluzionista spiegazioni sull'origine della vita? E' lecito chiederlo anche ad un fisico quantistico o ad un idraulico, ma se rispondono "non lo so" ciò non mette in discussione i modelli sui quali si basano per fare il loro lavoro.
E se lo cominci a chiedere "ripetutamente" ad un idraulico mentre ti sistema lo scarico del lavandino, molto probabilmente ti manda a quel paese

L'origine della vita è un altro problema, che richiede un'altra teoria. Se poi questa teoria sarà formulata e saprà spiegare ANCHE l'evoluzione meglio del neodarwinismo, bene, butteremo nel dimenticatoio l'ennesimo modello superato.
Altrimenti avremo due teorie, una per l'origine della vita ed una per la sua evoluzione (come mi sembra più naturale che sia, visto che la prima riguarda un contesto abiotico o al più prebiotico mentre la seconda un contesto prettamente biologico)


Lo riscrivo per la 150 volta.
Il neodarwinismo non si propone di spiegare l'origine della vita.
Se avete problemi con la speciazione chiedete al neodarwinismo.
Se avete problemi con l'origine della vita rivolgetevi a qualcun altro.

nessuno
Inviato: 12/8/2007 12:37  Aggiornato: 12/8/2007 12:37
Mi sento vacillare
Iscritto: 30/7/2005
Da: Albino (BG) - Bassa Valle Seriana
Inviati: 501
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Lo riscrivo per la 150 volta.Il neodarwinismo non si propone di spiegare l'origine della vita.
Se avete problemi con la speciazione chiedete al neodarwinismo.
Se avete problemi con l'origine della vita rivolgetevi a qualcun altro.


Ecco (finalmente) un discorso sensato

Buona vita

Guglielmo

"Quieremos organizar lo entusiasmo, no la obediencia" - Buenaventura Durruti
nottrz
Inviato: 12/8/2007 13:46  Aggiornato: 12/8/2007 13:46
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Massimo, ho letto con attenzione l'articolo e cercato i riferimenti citati.
Adesso con provo a chiarire come mai ci sia qualcosa di confuso nel ragionamento probabilistico che viene fatto.

Nell'articolo si dice "Se si ottiene sempre testa gettando una moneta un milione di volte, è più logico attribuirlo al caso o accettare che vi sia un intervento consapevole? La risposta dovrebbe essere ovvia."

Dovrebbe, ma in realta' non lo e'. Lanciando una moneta un milione di volte posso avere come risultato una tra 2 alla 1milione di sequenze possibili. Questo significa che _ognuna_ di queste sequenze ha una probabilita' di 1 su 2 alla 1 milione di uscire, tutte quante indifferentemente.
Esiste qualche sequenza preferenziale tra queste? La risposta da un punto di vista del calcolo delle probabilita' classico e' un categorico no.

Se scrivessimo su un foglio una sequenza qualsiasi di 1 milione di testa e croce (TTCTCTTCCCT..) ed eseguissimo poi il nostro lancio dovremmo certamente pensare ad un miracolo se estraessimo proprio la nostra sequenza visto che la probabilita' di ottenere proprio quella sequenza era minima.
Il punto e' che noi, tra tutte le sequenze possibili, abbiamo fissato _a priori_ proprio quella, cosi' come incosciamente avevamo prefissato nella nostra mente la sequenza di tutte teste come sequenza speciale.

Penso che fin qui non ci sia nulla di particolarmente strano.

Una conseguenza pero' di queste considerazioni e' che eventi con probabilita' infinitesima si verificano sistematicamente ogni giorno. Tutte le sequenze del mio lancio delle monete erano assolutamente improbabili, eppure qualcuna dovra' pur uscire fuori. La probabilita' di cui stiamo parlando e' molto inferiore a quelle citate nell'articolo: dobbiamo quindi presupporre un intervento "intelligente"?

Il passaggio debole dell'articolo e' questo: "una proteina di media dimensione è composta di 288 amminoacidi, dei quali esistono dodici tipi differenti. [...] Di tutte queste possibili sequenze, soltanto una forma la desiderata molecola proteica. Il resto di esse sono catene di amminoacidi che possono risultare o del tutto inutili o potenzialmente dannose per gli esseri viventi."

Personalmente ho forti dubbi che tra tutte le possibili combinazioni di cui parla ce ne sia davvero sola una in grado di svolgere la funzione desiderata, ma lo accetto. Quindi i suoi calcoli sono formalmente corretti e le sue considerazioni anche.
Quello che secondo me non e' lecito sono due aspetti: fissare a priori quella proteina e intervenire in modo chirurgico su un organismo complesso.

Oggi, alla fine del sorteggio, troviamo quella proteina e ci chiediamo: se dovessimo fare un'altra estrazione indipendente che probabilita' avremmo di ottenere di nuovo quella stessa proteina? Ma visto che nella prima estrazione quella proteina non era stata fissata non ha senso l'uso della risposta.

Il secondo aspetto e' intervenire su un organismo che si e' evoluto in modo complessivo, modificarne un pezzetto e vedere cosa viene fuori. Le varie parti di un organismo si sono evolute assieme. Se milioni di anni fa avessimo sostituito quella proteina con un'altra, il resto dell'organismo si sarebbe adattato di conseguenza e oggi avremmo un organismo diverso da quello che conosciamo e al posto della proteina originaria ne avremmo una altrettano _improbabile_. In altre parole l'importanza che ha quella specifica proteina e' contingente, non e' fissata a priori.

Ribaltando completamente il punto di vista: con le sostante e il contesto chimico/fisico presente sulla terra quanti altri tipi di forme di vita si sarebbero potuti ottenere? Oppure, in versione piu' soft, in quanti altri modi si sarebbe potuto ottenere i meccanismi regolatori presenti nel corpo umano? Era possibile sviluppare meccanismi regolatori basati su funzionamenti completamente diversi?
Detta terra terra: al posto dell'adrenalina avrebbe potuto esserci un'altra sostanza, e i relativi recettori, a svolgere la stessa funzione? Avremmo potuto avere un polmone solo o 4 al posto di due?
La risposta a tutte queste domande secono me e' si' e questo rimuove il vincolo di fissare a priori il risultato dell'estrazione comprando un unico biglietto. C'erano moltissimi modi in cui noi potevamo essere realizzati, in pratica abbiamo comprato un sacco di biglietti e uno tra quei tanti e' stato quello vincente. Certo, non saremmo stati esattamente noi, ma chi ha detto che noi fossimo una forma preferenziale?

Di questo uso improprio del calcolo delle probabilita' se ne sono resi conto anche i promotori dell'Intelligent Design e Dembski, per esempio, e' corso ai ripari aggiungendo il concetto di "specified complexity" ma qui si apre un altro discorso.



Aggiungo solo due note sui riferimenti citati (critiche ad hominem, ma visto che vengono citati come ipse dixit per avvalorare la tesi...).

- Harold F. Blum

http://www.daviddarling.info/encyclopedia/B/Blum.html

Da un paio di ricerche sembra abbia pubblicato solo un libro nel 51 e dalla considerazione termodinamica che gli viene attribuita nel link qui sopra pare abbia le idee un po' confuse tra sistemi chiusi e aperti. D'altra parte mi sembra di capire che fosse un medico.

- Perry Reeves

Non ho trovato nessun riferimento.

- Sir Fred Hoyle, Chandra Wickramasinghe

Famosi astronomi che si sono dedicati al problema dell'origine della vita.

andal
Inviato: 12/8/2007 13:54  Aggiornato: 12/8/2007 13:54
Ho qualche dubbio
Iscritto: 4/10/2006
Da:
Inviati: 58
 Re: Gli anelli mancanti continuano ad aumentare
nottrz: andal , bella domanda. Mi puoi citare qualche esempio? Sono proprio uguali uguali?


ho postato un link sopra il museo dei fossili dai una occhiata ...

Oldboy
Inviato: 12/8/2007 14:38  Aggiornato: 12/8/2007 15:50
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Mi fa piacere che Mazzucco abbia apprezzato l'argomento antievoluzionista della pila di mattoni.
(Come dicevo è tratto dagli scritti di Harun Yahya.)

Ma quello è solo l'esempio più elementare.
Se io trovo una pila di mattoni nel deserto, non penserò mai che il puro caso abbia fatto sì che l'argilla del terreno si unisse a formare, in migliaia di anni, un singolo mattone, poi un altro identico al primo, e così via.
Né penserò che il vento li abbia infine collocati uno sopra l'altro, come oggi li vedo...

Eppure l'evoluzionista "ragiona" così, non solo davanti a una formazione elementare come una pila di mattoni.
Ma - ecco il punto - perfino di fronte a realtà immensamente più complesse.

La cellula è talmente complessa che gli studiosi la paragonano a un'astronave, oppure a una grande fabbrica, completa di catene di montaggio e uffici amministrazione.
(Ma è un'analogia per difetto, perché la cellula è ancora più complessa, tanto che ancora oggi siamo ben lontani dal conoscere a fondo il suo funzionamento.
Se lo conoscessimo, avremmo debellato il cancro da un pezzo.)

Chiunque di noi, quando vede uno stabilimento industriale, pensa subito: è stato progettato da un'équipe di ingegneri.

L'evoluzionista vede quella fabbrica miniaturizzata che è la cellula - ne vede anzi miliardi e miliardi - e pensa:
"Nessun progetto intelligente, per carità! Sono stati il caso e il tempo, moltissimo tempo, a fare tutto il lavoro.
Prima c'era sono materia inorganica, ma poi piano piano, dando tempo al tempo..."

Oldboy
Inviato: 12/8/2007 15:17  Aggiornato: 12/8/2007 15:45
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
D'altronde, è evidente alla ragione che il caso e il tempo - fosse anche un tempo lunghissimo - non sono in grado di organizzare nulla di realmente complesso.

Come spiega Maurizio Blondet: prendiamo un recipiente piatto, e ricopriamo il suo fondo con uno strato di palline nere.
Al di sopra, mettiamo uno strato di palline bianche.
Dopodiché, scuotiamo il tutto.

Una volta mescolate, le palline bianche e quelle nere non torneranno mai più nella posizione originaria, dovessimo continuare a scuotere il recipiente per milioni di anni...

Servirà un intervento esterno, un intervento intelligente per riportarle nella posizione originaria.
Così come era servito il mio intervento intelligente per collocare tutte le sferette nere in basso, e tutte le bianche in alto.

E qui parliamo ancora di palline in un recipiente: figurarsi se il caso e il tempo possono mai organizzare l'immensa complessità delle creature viventi!
Crederlo, come fanno gli evoluzionisti, sarebbe credere - davvero - nei miracoli...

nottrz
Inviato: 12/8/2007 16:48  Aggiornato: 12/8/2007 16:48
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Oldboy:
Citazione:
D'altronde, è evidente alla ragione che il caso e il tempo - fosse anche un tempo lunghissimo - non sono in grado di organizzare nulla di realmente complesso.


Scusate se sto scrivendo molto, ma ci tengo a provare a fissare dei paletti per circoscrivere la discussione.

L'evoluzione non lavora per caso. Le mutazioni sono casuali, la ricombinazione e' casuale ma la selezione naturale no.

Se al mio antenato del toro spuntano delle corna, ovvero una caratteristica vantaggiosa, sara' poi la selezione naturale a ottimizzare quella caratteristica in un modo che potrebbe quasi apparire finalistico.
Affinche' le corna diventino piu' efficaci non servono altre mutazioni: gli individui non sono tutti uguali, ci sono quelli piu' alti, piu' forti, ecc. e cosi' anche il nuovo tratto sara' differenziato. Quelli con le corna migliori troveranno da mangiare, avranno la meglio nelle competizioni per l'accoppiamento e si riprodurranno di piu'.
Nella sopravvivenza/accoppiamento il nuovo tratto viene effettivamente messo alla prova in modo esplicito e perfezionato solo grazie alla ricombinazione (accoppiamento) e alla naturale diversita' degli individui.

Da fatto, con le dovute approssimazioni, le mutazioni si occupano di introdurre nuove "proposte" che gli altri meccanismi verificano e raffinano.

Citazione:
Come spiega Maurizio Blondet: prendiamo un recipiente piatto, e ricopriamo il suo fondo con uno strato di palline nere.
Al di sopra, mettiamo uno strato di palline bianche.
Dopodiché, scuotiamo il tutto.


Potrei dirti che se prendi delle palline piu' grandi e altre piu' piccole mescolate e scuoti la scatola, per magia?, quelle piu' grosse si disporranno sotto alle altre, ma non e' questo il punto.

Quello che viene descritto e' un sistema chiuso e quindi tende al disordine.
Gli esseri viventi non sono sistemi (termodinamici) chiusi, ma sono sistemi aperti e sono molto diversi. Gli esseri viventi sono considerati strutture dissipative e confondere i due casi cambia molto la situazione.

Il caso puo' creare ordine? Si', ci sono diversi esempi e studi al riguardo nell'ambito delle ricerche sulla complessita'.

olah
Inviato: 12/8/2007 17:05  Aggiornato: 12/8/2007 17:36
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
D'altronde, è evidente alla ragione che il caso e il tempo - fosse anche un tempo lunghissimo - non sono in grado di organizzare nulla di realmente complesso.


Prova a dimostralo...

A parte il fatto che un sistema caotico può dare origine a forme complesse in modo deterministico e senza l'intervento di esseri intelligenti, io ho riportato l'esempio delle geometrie frattali ma ci possono essere tanti altri esempi che si possono fare. Tutti i sistemi caotici tendono alla complessità.
Ricordati che tu stesso sei stato una cellula: come ha fatto quella cellula a diventare te? Per ispirazione divina? o qualcuno ti ha costruito mettendo a posto i pezzi?

A parte questo dicevo... prova, se provi a dimostrare che in uno spazio e un tempo infiniti un evento è impossibile perché improbabile, così magari ti rendi conto del cotrario.

Polidoro
Inviato: 12/8/2007 17:07  Aggiornato: 13/8/2007 10:04
Mi sento vacillare
Iscritto: 9/4/2005
Da:
Inviati: 488
 Re: Gli anelli mancanti continuano ad aumentare
http://www.mukto-mona.com/debunk/harun_yahya/index.htm

Chi è Harun Yahya ?

Harun Yahya è un ciarlatano ed un uomo pericoloso.
Ecco qualche cenno sul passato di questo grande impostore:

Adnan Oktar (Harun Yahya) si autodefinisce nel suo sito web un “universalmente riconosciuto e stimato scienziato” che si è dedicato a scrivere su fatti scientifici e religiosi come la teoria dell’evoluzione e i miracoli di Dio. Egli è inoltre descritto dai sostenitori come un rispettato “scienziato” con pubblicazioni su aree di interesse incredibilmente varie (attualmente è privo di laurea).

Il fatto è che le sue pubblicazioni e la sua fondazione (Science Research Foudation) sono state recentemente messe al bando in Turchia e la maggior parte dei membri della sua “setta” sono sotto processo. Il che non è dovuto alle loro attività Islamiche e scientifiche , ma a crimini come ricatto, estorsione, possesso di armi senza licenza e raporti sessuali con minori.

Circa tre anni fa, a seguito di querele delle vittime e dopo molti anni di indagini, la polizia Turca ha perquisito gli immobili di questo gruppo. Le scoperte nelle case e le testimonianze dei membri del gruppo sono state scioccanti.

Dietro la facciata del diffondere l’Islam e delle attività scientifiche i membri del gruppo sono risultati implicati in intense attività criminali includenti ricatto, possesso d’armi senza licenza e rapporti sessuali con persone sotto i 18 anni.

Il capo del gruppo, Adnan Oktar (filmato da camere della polizia e mostrato su canali TV Turchi come Kanal D, ATV, Star) ha confessato di aver ricattato persone che erano di ostacolo ai loro scopi. Queste persone includevano reporters del giornale Hurriyet, Emil Colasan, e Faith Altayli, dopo che essi avevano indagato su alcune attività di Harun Yahya come il corrompere la municipalità di Ankara.

Anche politici come Celal Adan (Membro del Parlamento) e Mesut Ylmaz (precedente Primo Ministro Turco) sono stati vittime di questo gruppo. La banda di Oktar aveva preparato fomontaggi di Yesut Yilmaz in vesti Massoni e fabbricato un falso certificato di associazione Massonica per lui. Questo falso era stato preso per vero e pubblicato in diversi giornali pro-islamici (senza sapere che era una frode). Come risultato il Primo Ministro era stato seriamente danneggiato politicamente per rimanente periodo di governo.

Si era anche scoperto che una modella di nome Ebru Simsek era stata ricattata e quindi diffamata come “prostituta” in messaggi-fax spediti a centinaia di Giornali, canali TV, grandi ditte, consolati stranieri, uffici governativi etc.. La ragione di tale diffamazione ? Si era rifiutata di avere rapporti sessuali con Adnan Oktar.

Ma le più scioccanti attività di Oktar e dei suoi seguaci non erano state queste. Nell’irruzione fatta furono trovati 20 donne e 2 uomini. La maggior parte delle donne (in realtà ragazzine) avevano meno di 18 anni (Oktar è sulla cinquantina) e dissero di aver avuto rapporti sessuali con Oktar e membri della sua setta.

Lui e i suoi seguaci dichiararono di aver avuto rapporti solo “anali e orali”. Essi preferivano questo genere di attività sessuali poiché in accordo con il Corano, Lui dichiarò, "tali atti non erano proibiti fuori dal matrimonio". Secondo la loro interpretazone “il rapporto vaginale” era “haram” ma quelli “orali e anali” erano “halal” quando non sposati.

[secondo me doveva dire che stava studiando la creazione per le suddette vie]

E così indovinate cosa è successo alla fine ?
La Science Research Foundation fu chiusa. Adnan Oktar (aka Harun Yahya) e circa 40 dei membri della sua setta furono processati e giudicati. In giudizio essi ritrattarono le loro confessioni dichiarando che erano state estorte con la tortura.

Il processo durò più di due anni, durante i quali la maggior parte delle vittime ritirò le denuncie a causa delle minacce o corruzioni da parte della setta. Come risultato finale la maggior parte dei casi furono chiusi e solo due andarono in galera per 1 anno.

Detto questo, la risonanza sulla stampa degli arresti e dei processi fu così grande in Turchia che la reputazione (e l’opportunità di finanziamenti) del gruppo fu permanentemente distrutta. Esso ora è preso seriamente solo all’estero dove i suoi guai legali non hanno quasi avuto alcun rilievo nei media.


Più che la Creazione a Costui piacean le Creature: che Uomo !

intelligent design ? Trame sottili ?



"Il vero viaggio di scoperta non consiste nel cercare nuovi orizzonti ma nell'avere nuovi occhi." Marcel Proust
Oldboy
Inviato: 12/8/2007 17:29  Aggiornato: 12/8/2007 17:29
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Ti faccio notare, Polidoro, che non serve a nulla screditare personalmente Harun Yahya.
I libri prima si leggono, e poi si discutono per i loro contenuti, non per la biografia del loro autore.

Il tuo è il classico argomento ad personam: se lo usi è perché, evidentemente, non trovi argomenti migliori...

andal
Inviato: 12/8/2007 17:34  Aggiornato: 12/8/2007 17:34
Ho qualche dubbio
Iscritto: 4/10/2006
Da:
Inviati: 58
 Re: Gli anelli mancanti continuano ad aumentare
nottrz..

che ne dici dei fossili ? anche quelli sono casuali ?

Polidoro
Inviato: 12/8/2007 17:50  Aggiornato: 12/8/2007 17:50
Mi sento vacillare
Iscritto: 9/4/2005
Da:
Inviati: 488
 Re: Gli anelli mancanti continuano ad aumentare
Oldboy:

io ho riportato notizie e per quanto ho potuto (il turco non lo so), ho verificato. Ed è tutto vero, mi sembra.
Ho riportato il collegamento così che uno possa leggerlo in originale.
E l'ho tradotto per facilitare altri che non sapessero l'inglese.

Se tu dici che io "scredito" Harun Yahya" devi dirmi se quello che riporto è falso: lo è ? Hai altre informazioni ? Non mi sembra, dici solo che "scredito", ma il "credito" che tu evidentemente hai per questa persona da cosa lo ricavi? puoi spiegare ?

Io il libro l'ho visto (lo dico in un post precedente), e sono rimasto stupefatto (lo spiego sempre nel post). Credo che pochi altri qui l'abbiano visto o tantomeno letto.

Tu hai letto il libro ? Se non lo hai fatto (se) perché lo giudichi positivamente accusando me di giudicarlo a priori negativamente ?

Ripeto: ho riportato notizie vere. Che interesse potrei avere a "screditare" uno sconosciuto ?

Cordialmente

"Il vero viaggio di scoperta non consiste nel cercare nuovi orizzonti ma nell'avere nuovi occhi." Marcel Proust
Oldboy
Inviato: 12/8/2007 17:56  Aggiornato: 12/8/2007 18:24
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Come dice Michael Behe, teorico dell'Intelligent design,
la casualità è nemica dell'ordine.

Questo principio è vero in ogni ambito: ad esempio nel linguaggio.
Se io cambio alcune lettere di questa frase, scegliendole a caso, la frase non avrà più significato, e conterrà errori di grammatica e di sintassi.

Ed è vero nel DNA, che è una sorta di linguaggio, o meglio di codice.
Le mutazioni casuali portano malattie e deformità: ci vuole un ottimismo infantile per credere che possano portare - molto spesso - a rendere l'individuo "più adatto a sopravvivere"...

Perfino lo scienziato evoluzionista Warren Weaver, commentando la relazione della Commissione sugli effetti delle radiazioni atomiche, ha scritto:

"Molti resteranno sconcertati dall'affermazione che in pratica tutti i geni mutanti sono dannosi.
Quale buon effetto - quale evoluzione verso forme più elevate di vita - può derivare da mutazioni che risultano tutte dannose?"

E d'altronde, come potrebbe essere altrimenti?
Se io ho un congegno complesso, mettiamo un televisore, e ne cambio alcuni pezzi a caso, che cosa succederà?
Forse che il televisore funzionerà meglio?...

E gli organismi viventi sono molto, molto più complessi del mio vecchio Mivar a 18 pollici...

Oldboy
Inviato: 12/8/2007 18:10  Aggiornato: 12/8/2007 18:55
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Polidoro:

certo che ho letto i libri di Harun Yahya, ma il punto è che i libri si discutono per i loro contenuti, non per la biografia del loro autore.
(Il tuo, come dicevo, è il classico argumentum ad personam.)

Da come spiega le varie questioni, il tizio mi pare un buon divulgatore scientifico.
Altro non so, né mi interessa sapere.

nottrz
Inviato: 12/8/2007 18:28  Aggiornato: 12/8/2007 18:28
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
che ne dici dei fossili ? anche quelli sono casuali ?


Riguardo ai fossili viventi ho guardato il sito che mi hai indicato e anche wikipedia, scoprendo tra l'altro che il termine e' dello stesso Darwin

http://it.wikipedia.org/wiki/Fossili_viventi

Su wikipedia vengono distinti tre casi.

- Organismi che sono gli unici rappresentanti viventi di gruppi estinti da tempo.

Questo credo non crei alcun problema per il punto di vista evoluzionistico: e' stata l'unica forma tra quelle del suo ramo in grado di adattarsi al nuovo ambiente. I suoi lontani cugini si sono estinti.

- Organismi che mantengono caratteri primitivi del gruppo che si è invece altamente differenziato.
- Organismi che rimangono immutati per un lungo intervallo di tempo.

Questi li metto assieme nel senso che il primo penso sia un caso speciale del secondo: abbiamo una specie immutata da molto tempo che nel primo caso ha pero' dato origine ad altre specie mente nel secondo no.

Le considerazioni su questo sono le stesse dell'altro post. Come mai una specie si evolve? Per adattarsi ad un nuovo ambiente e/o per adattarsi meglio al proprio ambiente. Quindi basterebbe pensare che il loro ambiente/ecosistema non abbia subito grossi cambiamenti per trovare logico il fatto che non siano cambiati molto.

Oppure la considerazione che i processi di ottimizzazione cmq rallentano sempre di piu' mano a mano che avanzano. Una volta che ci si e' specializzati molto su un particolare territorio dopo un po' ci si ferma. E' possibile iniziare ad esplorare altri habitat adattandosi a quelli (vedi il primo caso).

Nel caso del limulo mi chiedo: esistono predatori di questo coso? Non credo sia tanto comodo da mangiare. Magari se ne sta zitto zitto sul fondo del mare e non disturba nessuno.
Detta seriamente potrebbe anche essere rimasto l'ultimo frammento di una catena alimentare che nel tempo si e' spezzata. Non ha piu' predatori, quindi la selezione dei piu' forti e' data solo dall'ambiente circostante e quindi meno efficace (anche il limulo lento e con il guscio fragile sopravvive).

Secondo me quindi, quali che siano le spiegazioni per i singoli casi, non ci sono motivi per considerarli contro l'evoluzionismo. Dico sinceramente, li trovo perfettamente compatibili. Tra tutte le specie alcune si sono evolute piu' lentamente, altre hanno dato origine a piu' rami, ecc.

Fammi sapere se ti sembra un'arrampicata sugli specchi o meno, a me sembra ragionevole come spiegazione (logica, verificabile, ecc.).

Polidoro
Inviato: 12/8/2007 18:28  Aggiornato: 12/8/2007 18:28
Mi sento vacillare
Iscritto: 9/4/2005
Da:
Inviati: 488
 Re: Gli anelli mancanti continuano ad aumentare
Oldboy:

ti domando:

dato che non sono in vendita, tranne uno, piccolissimo ed in inglese, posso sapere dove li hai trovati, in una biblioteca ?

Come posso leggerli se non sono in vendita ?
(cioè: su Amazon ce ne sono 48 ma su bookshop solo 1 e non l'Atlas of Creation)

Sempre cordialmente, mai ad personam


"Il vero viaggio di scoperta non consiste nel cercare nuovi orizzonti ma nell'avere nuovi occhi." Marcel Proust
Oldboy
Inviato: 12/8/2007 18:36  Aggiornato: 12/8/2007 18:46
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Polidoro:

anche la mia risposta, un po' ruvida, non voleva essere polemica nei tuoi confronti.
Trovare i libri di Harun Yahya, comunque, è facilissimo: sono tutti scaricabili gratuitamente da Internet.
(Io inizierei con "L'inganno dell'evoluzione".)
L'indirizzo è www.harunyahya.org

Oldboy
Inviato: 12/8/2007 19:10  Aggiornato: 13/8/2007 0:52
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Come dicevamo, la casualità è nemica dell'ordine. (Michael Behe)

Se io prendo un organismo complesso, e ne muto alcune parti a caso, è impossibile che quell'organismo ne tragga un beneficio.
E' impossibile statisticamente, e direi anche logicamente.

Se io cambio una parte a caso di un motore, o di un televisore, sono un illuso se penso di averlo reso "più efficiente", o "più adatto".
L'unico risultato è che dovrò chiamare al più presto un bravo tecnico specializzato.

Solo il suo intervento intelligente potrà rimediare al guasto che io, affidandomi al caso, ho provocato.

Ma se questo è vero per i congegni creati dall'uomo, è ancora più vero per le creature viventi, che sono straordinariamente più complesse di qualsiasi televisore.
(Tant'è vero che siamo ancora lontanissimi dal conoscerle in ogni aspetto.)

Ecco perché gli evoluzionisti hanno sempre fallito, nel tentativo di riprodurre in laboratorio una mutazione "benefica" per l'individuo che la subisce.
(Poveri moscerini da frutta, veri martiri della scienza...
Sono più di settant'anni che gli scienziati li sottopongono a condizioni estreme di caldo, freddo, luce, oscurità, trattamenti chimici e radioattivi, ma loro niente!
Si limitano a morire o a diventare sterili...)

nottrz
Inviato: 12/8/2007 20:22  Aggiornato: 12/8/2007 22:04
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Polidoro, ti meriti il Pulitzer per l'indagine! :)

Oldboy
Citazione:
la casualità è nemica dell'ordine


Molti ricercatori non condividono questa tesi.
Per essere esatti un'eccessiva casualita' va contro la realizzazione di strutture complesse, cosi' come un eccessivo ordine. La regione intermedia tra i due estremi, che viene chiamata margini del caos, e' la zona ideale dove si vedono comparire piu' facilmente strutture complesse.
Quindi un po' di casualita' aiuta, troppa no.

Nota che non ho ripreso il termine ordine, ma ho usato sistema complesso. Un organismo vivente non e' ordinato ma e' complesso.
Un cristallo o una biblioteca sono ordinati, ma un essere vivente e' molto piu' dinamico/ricco perche' questo termine sia adatto a descriverlo.

Citazione:
Se io cambio alcune lettere di questa frase, scegliendole a caso, la frase non avrà più significato, e conterrà errori di grammatica e di sintassi.


Questo tuo esempio e' interessante. Se cambi alcune lettere, diciamo una decina, la frase continuera' a poter essere letta e quindi ad avere il suo significato. Questo perche' nel nostro linguaggio c'e' molta ridondanza e siamo in grado di intuire il significato delle parole anche a fronte di piccoli errori.

Un _meccanismo_, come un orologio a molla o un televisore non hanno ridondanze e quindi sono estremamente fragili. Qualunque piccola modifica li distrugge.

Gli _organismi_ invece sono estremamente ridondati in tutte le loro funzioni e le varie parti hanno anche un'ottima dose di adattabilita'
Non basta un piccolo errore o una piccola differenza per compromettere il funzionamento complessivo dell'organismo.
Basta guardarsi attorno, limitandosi al solo aspetto fisico, per rendersi conto che ci sono grosse differenze tra le diverse persone. E ancora si potrebbe approfondire l'analisi guardando anche all'interno come diceva Morfeo a proposito dell'emoglobina.
Nonostante tutte queste differenze il meccanismo principale del nostro corpo funziona perfettamente. In alcuni magari meglio e in altri peggio, ma di base il giro gira.

Sul discorso mutazioni vorrei un po' di statistiche. Se una mutazione non e' dannosa come si fa ad accorgersi che e' avvenuta? Supponiamo che un mio gene sia mutato e che quindi il mio fegato funzioni in modo un po' diverso da quello dei miei genitori. Probabilmente nessuno lo sapra' mai. Ovviamente qui assumo che mutazioni non distruttive siano in linea di principio possibili.

Apro poi una parentesi sulle mutazioni viste dal punto di vista degli algoritmi genetici.
Gli algoritmi genetici sono una tecnica di ricerca in cui l'algoritmo viene descritto come sequenza di "istruzioni". Se crea un buon numero di sequenze e le si lascia agire, incrociate e selezionate in base alla loro bonta' rispetto al risultato atteso.
Come riporta anche wikipedia le mutazioni vengono usate principalmente per effettuare grandi salti nello spazio delle alternative.

Il discorso, riassunto il piu' possibile e' questo. Vengo paracadutato di notte su una catena montuosa a me sconosciuta e devo cercare di arrivare piu' in alto possibile per segnalare la mia presenza. Ho a disposizione un teletrasporto random e un altimetro. Ho poco tempo se no muoio di fame. Qual'e' la migliore strategia da utilizzare?
Il tema e' quello dell'esplorazione di paesaggi di fitness.
Posso prendere e arrampicarmi sulla prima salita che vedo, c'e' qualche stella quindi vedo a qualche metro di distanza. Solo che a meno di essere stato molto molto fortunato quella sara' una montagna di media altezza e arrampicarmi costa fatica. Posso usare il teletrasporto e finire in un posto a caso, magari peggio di quello dove sono adesso.

Il tema e' lungo e ci sono diverse strategie possibili, quasi tutte si articolano su una prima fase in cui si ricerca una buon punto di partenza e poi si inizia a salire.
Nel nostro esempio si userebbe prima il teletrasporto un po' di volte per farsi un'idea delle altitudini e poi si andrebbe a cercarne una ben al di sopra della media da cui iniziare la scalata.

Nel caso dell'evoluzione piu' un organismo si specializza rispetto al proprio ambiente piu' si colloca in cima ad una montagna (alto fitness). Non e' detto che quella sia la montagna piu' alta, ma esplorare le alternative significa scendere e risalire.

Spero di non essere stato troppo sintetico.

Cosa centrano le mutazioni? Le mutazioni sono utili, negli algoritmi genetici, per effettuare i long jump, cioe' l'esplorazione iniziale. Non ci siamo ancora adattati all'ambiente, siamo dei batteri o giu' di li' e la selezione naturale lascia in gioco solo quelli piu' adatti. Diciamo che peggio di cosi' non ci puo' andare quindi e' probabile che una mutazione ci porti dei vantaggi.
Ma piu' ci specializziamo, saliamo in alto, e piu' i long jump, il teletrasporto, diventano pericolosi perche' se la nostra situazione e' ben al di sopra della media dovremmo essere estremamente fortunati per essere portati su una cima piu' alta.
A volte le mutazioni non sono usate, altre volte la loro frequenza viene fatta diminuire con il passare delle generazioni, in modo che ce ne siamo sempre meno mano a mano che i singoli "geni" in gioco si collocano sulle loro vette.

Quindi trovo ragionevole che in un organismo altamente specializzato come un essere umano le mutazioni, quelle che hanno effetti visibili, siano spesso dannose.

Parentesi: molto spesso il materiale genetico iniziale e' completamente random e vengono applicati solo i meccanismi di ricombinazione, mutazione e selezione. [AGGIUNTO] In alcuni casi il meccanismo di mutazione non viene usato del tutto.
Per alcuni tipi di problemi gli algoritmi genetici arrivano a soluzioni molto buone (tra le migliori che abbiamo).

Sempre dagli algoritmi genetici vediamo che il loro contenuto e' molto ridondato e molto resistente agli errori. Si possono alterare un buon numero di geni senza che il risultato complessivo cambi di molto. [AGGIUNTO] E questo, cito di nuovo Morfeo, vale anche per le proteine (amminoacidi chiave).
Questo perche' il loro comportamento e' distribuito in modo combinatorio lungo tutta la sequenza e non e' localizzato in un singolo punto.

Questo stessa situazione la si osserva, ma ditemi se gli articoli che ho letto sono dubbi, nel nostro dna: un gene non si occupa mai di una singola funzione e la stessa funzione non e' mai localizzata unicamente in un gene. In realta' la cosa e' spesso piu' aggrovigliata con piu' geni che contribuiscono ad uno stesso compito e viceversa.

Come se in un ufficio tutti sapessero fare tutto, magari piu' o meno bene: se si ammala qualcuno e' facile trovare qualcuno che lo sostituisca senza bloccare tutta la ditta.

Polidoro
Inviato: 12/8/2007 20:34  Aggiornato: 12/8/2007 20:34
Mi sento vacillare
Iscritto: 9/4/2005
Da:
Inviati: 488
 Re: Gli anelli mancanti continuano ad aumentare
nottrz

Grazie del Pulitzer, nottrz.

Ti compenso con un articolo di Ümit Sayin (turco pure lui)
Islamic Scientific Creationism: A New Challenge in Turkey

......BAV (Science Research Foundation) and its Activities
BAV is a radical fundamentalist foundation established in 1991 by Sheikh Adnan Oktar. It is an integral part of the rise of fundamentalist Islam in Turkey. BAV is not an independent organization and the source(s) of its funding remain very obscure. Its activities and publications utilize millions of dollars each year, so it is difficult to imagine that this amount of funding can be supplied just by donations, as some at BAV claim.....

........BAV has a long history of contact with American creationists, including receiving assistance from ICR. Duane Gish and Henry Morris visited Turkey in 1992, just after the establishment of BAV, and participated in a creationist conference in Istanbul......




"Il vero viaggio di scoperta non consiste nel cercare nuovi orizzonti ma nell'avere nuovi occhi." Marcel Proust
Anonimo
Inviato: 12/8/2007 21:47  Aggiornato: 12/8/2007 21:47
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Redazione: Io non faccio il chimico, e non è a me che devi dare certe spiegazioni tecniche. Se tu ritieni che quanto dici sia sufficiente a confutare per intero le critiche all'evoluzionismo che ho postato più sopra, ben per te.


Se si tirano in mezzo riferimenti tecnici, è logico che uno poi risponde tecnicamente.

Se si parla di probabilità nulla che una proteina abbia quella catena di aminoacidi, è logico che ti si dica che quella catena non deve essere fissa.

Io non voglio confutare per intero nulla, né voglio fare come Attivissimo che mi attacco alle piccolezze per distogliere l'attenzione.

Infatti ti ho detto che tu e nottrz dicevate cose compatibili tra loro.

Ma non puoi fondare un ragionamento su ragionamenti forzati basati su nozioni errate, come molti altri ti hanno fatto notare fin'ora.

E, torno a ripetere, i discorsi sono compatibili.

Non c'è crazionismo VS evolozionismo.

Può essere tranquillamente che gli omini verdi abbiamo seminato il pianeta, e di lì poi ci siamo evoluti.

Possono esserci tante spiegazion, ma almeno, se si tirano in mezzo nozioni scientifiche, che quantomeno siano esatte.

Per il resto ognuno creda quel che gli pare.

Oldboy
Inviato: 12/8/2007 22:10  Aggiornato: 12/8/2007 22:36
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Scusa, nottrz, ma sono oltre 70 anni che gli evoluzionisti cercano disperatamente di riprodurre la mitica, leggendaria mutazione "benefica".
(Quella che non provocherebbe malattie e deformità, ma anzi renderebbe l'individuo "più adatto a sopravvivere".)

Da oltre settant'anni bombardano i poveri moscerini della frutta con ogni sorta di flagello: condizioni estreme di caldo, freddo, luce, oscurità, trattamenti chimici e radioattivi.
(Hanno scelto di martirizzare i poveri moscerini perché producono una nuova generazione ogni 11 giorni.)

Tutto inutile, come spiega il genetista Gordon Taylor:

"Nonostante tutti gli esperimenti, i genetisti non hanno mai assistito all'emergere di una nuova specie, e nemmeno di un nuovo enzima."

Aggiunge il suo collega Michael Pitman:
"Ogni sorta di mutazioni, tutte insignificanti o deleteree, sono state prodotte.
In pratica i mutanti muoiono, diventano sterili o tendono a tornare al tipo primitivo."

Insomma, nessuno ha ancora dimostrato l'esistenza della mitica mutazione benefica...

Oldboy
Inviato: 12/8/2007 22:23  Aggiornato: 12/8/2007 22:33
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
D'altra parte, solo negli ultimi anni si è scoperto che il DNA dispone di un meccanismo di autocorrezione, simile ai programmi di correzione ortografica dei computer.

Questo è stato l'ennesimo duro colpo al dogma evoluzionista (dopo quelli venuti dalla biologia molecolare e dalla paleoantropologia).

Infatti, ora sappiamo che il DNA è una struttura molto più rigida di quello che si pensava, e capace di proteggersi dalle mutazioni.
Quando non ci riesce, ne derivano malattie e deformità: ecco perché i moscerini della frutta, meschinelli, bombardati dalle radiazioni si ostinano ad ammalarsi e morire...
(Senza dare mai una soddisfazione che sia una ai loro aguzzini evoluzionisti... )

I moscerini della frutta, come tutti gli altri esseri viventi, sono stati programmati per essere ciò che sono, e che sono sempre stati.
Dovessero seviziarli per altri 70 anni e oltre, continueranno a essere sempre le solite vecchie bestioline di sempre...

olah
Inviato: 12/8/2007 23:16  Aggiornato: 12/8/2007 23:16
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
oldboy,

se tutte le mutazioni sono lesive, allora noi dovremmo avere geni identici. Siamo forse gemelli?

olah
Inviato: 12/8/2007 23:40  Aggiornato: 12/8/2007 23:40
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
D'altra parte, solo negli ultimi anni si è scoperto che il DNA dispone di un meccanismo di autocorrezione, simile ai programmi di correzione ortografica dei computer.


I meccanismi di correzione si conoscono da molti anni e non somigliano affatto al correttore ortografico.

Citazione:
Questo è stato l'ennesimo duro colpo al dogma evoluzionista


Non è vero.

A parte il fatto che ci sono mutazioni non correggibili (ricombinazioni, inserizione di DNA virale ecc.), a volte sono proprio di meccanismi di correzione a distruggere un frammento di DNA e a ricostruirlo inserendo una mutazione.

Citazione:
Infatti, ora sappiamo che il DNA è una struttura molto più rigida di quello che si pensava


Al contrario, sappiamo che è molto più flessibile di quanto si pensasse un tempo. Pensa ad esempio ai trasposoni.

Citazione:
Quando non ci riesce, ne derivano malattie e deformità: ecco perché i moscerini della frutta, meschinelli, bombardati dalle radiazioni si ostinano ad ammalarsi e morire...


Molti mutanti sono vivi e vegeti. Ad esempio:

lilliputian: minori dimensioni
inebriated: maggiore sensibilità all'alchool
cheap date: vive più a lungo
brainiac: cervello più grande

La lista è molto lunga...

Oldboy
Inviato: 12/8/2007 23:45  Aggiornato: 12/8/2007 23:49
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
No, olah.
Tu mi insegni che un conto sono le micromutazioni all'interno della specie, un altro le - presunte - macromutazioni (che sarebbero alla base dell'evoluzione).

Le prime sono un fenomeno indubbio e facilmente verificabile: il colore dei nostri capelli può certo variare moltissimo, così come la nostra struttura fisica e moltissimi altri caratteri.
Ma sempre all'interno della specie umana, alla quale entrambi apparteniamo, e che resta sempre e comunque cio che è.

Le cosiddette macromutazioni, invece, che dovrebbero dare origine a nuove specie, non sono mai state dimostrate da alcuno.

Come dicevo, da settant'anni gli scienziati evoluzionisti seviziano i poveri moscerini della frutta, cercando disperatamente di indurre macromutazioni.
(Questi insetti hanno un ciclo vitale di pochi giorni, e quindi sembravano prestarsi bene agli esperimenti.)

I risultati sono miserevoli, come affermano senza mezzi termini i due studiosi che citavo due messaggi fa.
In tutti questi anni, non si è mai vista sorgere una nuova specie di moscerini, e nemmeno un nuovo enzima.
(Solo mostri mutanti, malati e sterili.)

olah
Inviato: 12/8/2007 23:45  Aggiornato: 12/8/2007 23:45
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Ogni sorta di mutazioni, tutte insignificanti o deleteree, sono state prodotte.
In pratica i mutanti muoiono, diventano sterili o tendono a tornare al tipo primitivo.


Cheap date, il mutante di drosofila che vive più a lungo, ha appena avuto un'altra mutazione: un set di dita prensili che fanno le corna.

olah
Inviato: 12/8/2007 23:53  Aggiornato: 13/8/2007 0:02
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Tu mi insegni che un conto sono le micromutazioni all'interno della specie, un altro le - presunte - macromutazioni (che sarebbero alla base dell'evoluzione).


Adesso mi spieghi, dal punto di vista molecolare, la differenza tra micromutazione e macromutazione?

Quando dicevi che tutte le mutazioni sono letali o altamente deleterie, ti riferivi alle macromutazioni? Come distingui una micromutazione da una macromutazione?

Citazione:
Le cosiddette macromutazioni, invece, che dovrebbero dare origine a nuove specie, non sono mai state dimostrate da alcuno.


Chi ha mai detto che la nascita di una nuova specie debba dipendere da una singola mutazione? La speciazione è un fenomeno lungo.

Citazione:
In tutti questi anni, non si è mai vista sorgere una nuova specie di moscerini, e nemmeno un nuovo enzima.


Non si fanno esperimenti sulla drosofila per dimostrare l'evoluzione, è un fenomeno troppo lungo per poter essere riprodotto in laboratorio. Gli esperimenti di genetica sui moscerini hanno altri scopi.

C'è chi tenta selezioni artificiali per generare strani frutti tipo il cacomela... ma questa è un'altra storia...

Oldboy
Inviato: 13/8/2007 0:03  Aggiornato: 13/8/2007 0:20
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Olah,
ti faccio notare che tu parli della "nascita di una nuova specie" come se fosse un dato di fatto, indubbio e verificabile.

Ma il punto è che nessuno l'ha ancora dimostrata, verificata, riprodotta.
Prima di affermare che si tratta di "un fenomeno lungo", dovresti dimostrare in modo convincente che è avvenuta.

Il moscerino della frutta venne scelto come cavia ideale proprio perché ha un ciclo vitale brevissimo.
Ciononostante, 70 anni di sevizie sulle povere bestioline non hanno prodotto nulla: non solo una nuova specie, come dice Gordon Taylor, ma neppure un nuovo enzima.

Questo in italiano si chiama fallimento.
E c'è chi ne prende atto, fra gli studiosi: i due che citavo prima ne sono un esempio.

olah
Inviato: 13/8/2007 0:12  Aggiornato: 13/8/2007 0:12
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Prima di affermare che si tratta di "un fenomeno lungo", dovresti prima dimostrare in modo convincente che è avvenuta.


Diciamo allora che i modelli proposti non prevedono che le specie nascano dalla sera alla mattina. Così va bene?

Citazione:
Il moscerino della frutta venne scelto come cavia ideale proprio perché ha un ciclo vitale brevissimo.


Te lo ripeto, gli esperimenti di genetica sulla drosofila non sono nati per sperimentare la nascita di nuove specie.

Anche se dalla genetica abbiamo alcune informazioni interessanti. Lo sai ad esempio che i geni che controllano la segmentazione dell'embrione di drosofila sono gli stessi che controllano la segmentazine dei segmenti romboencefalici nel cervello umano? Non solo, sono disposti addirittura nello stesso ordine all'interno del cromosoma. Eppure l'odine dei geni nel cromosoma non dovrebbe essere così vincolante... i casi della vita...

Oldboy
Inviato: 13/8/2007 0:18  Aggiornato: 13/8/2007 0:57
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
D'altronde, è evidente alla ragione e all'esperienza che mutazioni casuali su organismi complessi possono solo danneggiare gli stessi organismi.

La ragione ci dice che un intervento inconsapevole su una struttura complessa non apporterà miglioramenti, ma piuttosto dei danni.
Solo un intervento intelligente - ecco il punto - può metter mano a un organismo complesso e funzionante, migliorandolo.

La casualità è nemica di ogni organizzazione, anche perché organizzazione è sinonimo di intelligenza.

(Tutti questi temi sono stati ampiamente trattati da Michael Behe e da William Dembski, i principali teorici dell'Intelligent Design.)

L'evoluzionista, invece, ragiona come un tizio che vede una città - con edifici, fabbriche, strade - e pensa:
"Nessuno l'ha progettata, nessuno l'ha voluta e costruita...
Il caso e il tempo, certo un tempo lunghissimo, hanno fatto tutto il lavoro..."

Polidoro
Inviato: 13/8/2007 0:52  Aggiornato: 13/8/2007 0:52
Mi sento vacillare
Iscritto: 9/4/2005
Da:
Inviati: 488
 Re: Gli anelli mancanti continuano ad aumentare

"Il vero viaggio di scoperta non consiste nel cercare nuovi orizzonti ma nell'avere nuovi occhi." Marcel Proust
slump
Inviato: 13/8/2007 1:16  Aggiornato: 13/8/2007 1:16
Ho qualche dubbio
Iscritto: 8/6/2006
Da:
Inviati: 199
 Re: Gli anelli mancanti continuano ad aumentare
Salute, a tutti.

Scrivo raramente anche se leggo con una certa frequenza il sito. Pur essendo quasi sempre in disaccordo con la Redazione devo dire che altrettanto frequentemente trovo, a partire dagli articoli e dai commenti, materiale interessante per riflettere e magari spingermi ad approfondire: questo thread sugli "anelli mancanti" è da questo punto di vista esemplare (per me almeno).

Intanto ho saputo che esistono personaggi come il genetista Sermonti e il fantomatico turco Harun Yahya dei quali ignoravo assolutamente l'esistenza (scartabellando un po' ho trovato che il turco si chiamerebbe in realtà Adnan Oktar).

Per quanto riguarda l'argomento in questione, evoluzionismo e darwinismo, cerco di dire il più brevemente possibile la mia.

Innanzitutto distinguerei tra "nascita della vita" ed "evoluzione delle specie": riguardo al primo punto non ritengo molto convincenti le teorie del "brodo primordiale" e derivate per spiegare la nascita dei primissimi protoorganismi capaci di replicarsi. Non le trovo convincenti ma sono le uniche che abbiano una qualche plausibilità scientifica: probabilmente ad esse manca qualcosa di fondamentale che sfugge (forse la conoscenza di qualche proprietà del materiale organico e/o genetico che ora ci è ignota) però è una base di partenza su cui lavorare.

Le alternative a questa teoria sono nei fatti due: o che il materiale organico provenga dallo spazio (es. tramite meteoriti) o che sia opera di un Creatore (divino o intelligenza extraterrestre). Nel primo caso il problema sarebbe solo spostato nello spazio e bisognerebbe sempre spiegare come le forme organiche abbiano avuto origine. Un altro "brodo primordiale" su un altro pianeta?

L'altra possibilità è un Creatore: se fosse uno divino il discorso scientifico sarebbe chiuso immediatamente -- se si giunge ad avere questa fede. Si aprirebbe però poi tutta una serie di problematiche teologiche non meno complicate di quelle scientifiche: dal capire CHI/COSA è Dio a COSA Dio abbia effettivamente creato (il batterio, l'alga, solo il DNA/RNA, specie intere ecc.), perché l'abbia creato in un determinato modo, perché qui in questo modo ecc. Duemila e passa anni di teologia andrebbero rispolverati e rimessi in moto e in discussione alla luce anche della odierna situazione scientifica, sociale, politica ecc.

Se il Creatore fosse inteso come un essere extraterrestre tecnologicamente avanzatissimo allora non solo non si chiuderebbe il discorso scientifico sulla nascita della vita (come sarebbe "nato" l'ET?) ma contemporaneamente si riaprirebbe il discorso filosofico e teologico
non solo sullo status del Creatore, le sue intenzioni, voleri, capacità ecc. ma anche sul nostro status di creature. Siamo veramente fatti di materia o siamo solo una simulazione al computer o magari solo il sogno di qualcuno?

L'obiezione che la nascita della vita organica sul nostro pianeta sarebbe stato un evento statististico assai assai improbabile per verificarsi sul serio, diciamo anche 1 su 2^9999999999999999999 (dove "^" sta per "elevato a" ma potete pure immaginare un un qualunque numero più grande) mi è sempre parsa sciocca: noi infatti non possiamo sapere quanti "tentativi" casuali siano stati fatti e in quanto tempo. Nell'universo potrebbero essere miliardi di miliardi i pianeti simili alla Terra primordiale su cui atomi e molecole hanno interagito tra loro SENZA produrre alcunché di rilevante dal punto di vista della "vita" come noi la vediamo. E questo nei miliardi di anni della vita dell'universo e magari, come ci suggerisce una parte della cosmologia, nei miliardi di anni dei miliardi di universi esistiti prima del nostro (teoria dell'universo che nasce, si espande, collassa, rinasce ecc.).

Facendo pigiare a caso i tasti della mia tastiera alla mia scimmietta quante possibilità ho che mi riscriva di getto, senza errori e senza caratteri estranei, il ciclo dei "Fabbricanti di Universi" di Farmer? O un qualunque altro libro? Ma se ogni anno, per miliardi di miliardi anni, vi fossero miliardi di miliardi di scimmie a fare il tentativo?

D'altro canto perché ci risulta più facile accettare che Farmer abbia scritto quel ciclo o Dante la "Commedia"? Quante probabilità c'erano che usassero quelle lettere e quelle parole e non altre? Dobbiamo pensare che quei libri li ha scritti Dio perché la statistica ci dice che era assai improbabile che fossero scritti in quel modo? A priori Dante poteva scrivere un numero elevatissimo (non so se infinito) di opere diverse, poco o tanto, dalla "Commedia" che conosciamo eppure accettiamo senza grosse remore che quel libro l'abbia scritto lui e non Dio! Se domani saprò che il mio vicino ha vinto, lui solo, al Superenalotto giocando un solo biglietto dovrò pensare a Dio perché le probabilità che, su quasi 60 milioni d'italiani proprio il mio vicino, giocando un solo biglietto, vinca, sono bassissime? Eppure al vicino di qualcuno non troppi anni fa è successo proprio questo.

Da questo punto di vista è più facile credere a un Dio creatore o "credere" a una qualche teoria scientifica più o meno plausibile e perfettibile? "Credere" di essere uno dei pochi, se non l'unico, vincitore al Superenalotto universale della vita o di essere una creatura del Signore? Certo il "credere" di essere solo un colpo riuscito in un casinò cosmico è facilmente disperante, può ispirare l'orrore di una infinita solitudine -- se poi guardiamo ai macelli e alla sofferenza che ci circondano quel colpo potrebbe apparirci tutto fuorché "fortunato". Dio invece, e tutto quel che ne consegue, (come la religione morale) è una prospettiva assai più consolante (oltre che essere assai più manipolabile politicamente causa la diversità di Dei e religioni --- ma questo è un altro discorso).

Passando invece all'evoluzione della specie anche la Redazione ha ammesso che vi sono alcune basi inconfutabili: anch'io lo penso così, come ritengo che anche in questo campo vi sia ancora molto da scoprire riguardo alla genetica e alla trasmissione dei caratteri. Non escluderei anche qualche forma di sottile lamarckismo mediato in qualche modo, ossia di influsso diretto dell'ambiente sul patrimonio genetico trasmesso alla prole: non lo escludo ma finora non è mai stato dimostrato (che io sappia almeno).

Meno male che dovevo essere breve...

"In powerful rain, they laid down their heads to die"
(My Dying Bride)
Redazione
Inviato: 13/8/2007 10:17  Aggiornato: 13/8/2007 10:24
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
Ciao SLUMP: Mi dispiace che tu sia quasi sempre in disaccordo con me, ma mi fa piacere che almeno tu trovi spunti utili per la riflessione (non sai la fatica che faccio, ogni volta, a scrivere quello in cui non credo, pur di stimolare discussioni interessanti ).

Vorrei controbattere solo su un punto, che per me è quello fondamentale: l‘esempio della scimmietta, che poi si riallaccia al discorso della “sequenza preferenziale” di NOTTRZ.

Tu domandi “Quante probabilità c'erano che [gli scrittori] usassero quelle lettere e quelle parole e non altre?”, e NOTTRZ domanda perchè, tirando per un milione di volte le monete, debba essere proprio la sequenza “tutto testa” ad essere quella favorita.

Il tutto equivale a dire, se ho capito bene, “chi ce lo dice che la nostra forma vitale sia necessariamente l’unica possibile nell’Universo?”

A sua volta, dato il principio per cui “se tiri le monete all’inifinito una certa sequenza prima o poi esce”, si conclude che non c’è nulla da stupirsi.

Giusto?

Se ci ho preso, la mia risposta è questa: prima di tutto, viviamo in un universo assolutamente finito, se non nello spazio, sicuramente nel tempo, e settecento milioni di anni equivalgono al primo tiro soltanto, in un tempo "infinito".

In secondo luogo, un romanzo “diverso” deve essere una sequenza di lettere INTERAMENTE SENSATA, e non una qualunque “altra” sequenza: il parallelo con “altre forme di vita” quindi regge, purchè sia chiaro che “romanzi con un diverso finale” equivale a “condizioni di vita necessarie e sufficienti”.

Ma quelle del romanzo sono variabili “orizzontali”, nel senso che una certa storia può prendere una piega piuttosto che un’altra, senza che la prima parte del racconto (buona parte delle tirate di dadi) vada buttata al cesso.

Mentre l’organismo umano è una complessità interindipendente (non ho i termini giusti, sforzatevi di capirmi), nel senso che basta che un ormone non funzioni e l’intero meccanismo muore.

Questo significa che la sequenza “tutto testa” è necessariamente l’unica accettabile, e riporta quindi il problema all’impossibilità statistica che io vado sostenendo dall’inizio.

(Un’altra forma di vita non sembra possibile, nello “stesso universo”, a causa di questa complessità “interindipendente”).

°°°

In ogni caso, vedo che oltre a qualche malcelata nota di razzismo verso il “povero turco”, nessuno ha provato a smontare veramente il suo ragionamento probabilistico.

(Anche accettando la possibilità che la serie “tutto testa” non sia l’unica accettabile, staremmo parlando di un numero di variabili infinitamente basso rispetto alle possibilità totali di combinazione).

shevek
Inviato: 13/8/2007 10:48  Aggiornato: 13/8/2007 10:48
Dubito ormai di tutto
Iscritto: 27/4/2005
Da: Napoli
Inviati: 1249
 Re: Gli anelli mancanti continuano ad aumentare
Salut y Libertad Oldboy!


Dici:Citazione:
negli ultimi anni si è scoperto che il DNA dispone di un meccanismo di autocorrezione, simile ai programmi di correzione ortografica dei computer.
(...) ora sappiamo che il DNA è una struttura molto più rigida di quello che si pensava, e capace di proteggersi dalle mutazioni.


Di là delle obiezioni di olah, ti vorrei chiedere se mi puoi dare qualche link in merito. Vedi, qualche anno fa un simpaticissimo scienziato russo ha "dimostrato" proprio questo e, qualche anno dopo, anche che la datazione della Sindone come falso medievale era sbagliata, perché, in presenza di forti fonti di calore (la Sindone è stata sottoposta ad un incendio), il test del Carbonio 14 viene alterato di quel tanto da far risalire la Sindone alla data "giusta".

Il problema era che entrambi i suoi studi erano letteralmente inventati, allo scopo di ottenere lauti finanziamenti dai fondamentalisti protestanti USA (nel primo caso), dalla Chiesa Cattolica nel secondo... Nonostante, la truffa sia stata scoperta alcuni anni fa, mi è capitato spesso di vederli citati come se niente fosse accaduto.


Salut y Libertad a todos... nel frattempo vado un po' in vacanza... appena becco un internet point ci rivediamo...

Shevek

"Il potere è l'immondizia nella storia degli umani" - F. Guccini
www.portadimassa.net - WEB-TV e non solo di Filosofia
olah
Inviato: 13/8/2007 10:50  Aggiornato: 13/8/2007 10:52
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Innanzitutto distinguerei tra "nascita della vita" ed "evoluzione delle specie": riguardo al primo punto non ritengo molto convincenti le teorie del "brodo primordiale" e derivate per spiegare la nascita dei primissimi protoorganismi capaci di replicarsi. Non le trovo convincenti ma sono le uniche che abbiano una qualche plausibilità scientifica: probabilmente ad esse manca qualcosa di fondamentale che sfugge (forse la conoscenza di qualche proprietà del materiale organico e/o genetico che ora ci è ignota) però è una base di partenza su cui lavorare.


Sono daccordo, nascita della vita ed evoluzione delle specie sono due fenomeni distinti. Ci sono però forme di evoluzione molecolare che non riguardano esseri viventi ma singole molecole. Esistono molecole che si autoreplicano per ragioni fini a sé stesse, per spinta selettiva all'autoconservazione. Pensa ad esempio ai trasposomi, molecole di DNA parassita che si autoreplicano all'interno del genoma. Ci può essere quindi una certa correlazione tra evoluzione molecolare e nascita della vita.

Per quanto riguarda le teorie sulla nascita delle vita, è molto difficile dimostrare come sia avvenuta dato che non è un fenomeno riproducibile in laboratorio, almeno per il momento. Data la complessità del fenomeno, difficile pensare che si possano fare delle deduzioni confidando sulla conoscenza della chimica biologica, per quanto ampia possa essere. In futuro, quando avremo una maggiore potenza di calcolo, forse si potrà cercare di emualre emulare il fenomeno con simulazioni al calcolatore: si mettono insieme vari ingredienti e si vede che succede, accellerando i tempi in modo che il tempo geologico diventi un tempo a misura d'uomo.

olah
Inviato: 13/8/2007 11:13  Aggiornato: 13/8/2007 11:13
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Se ci ho preso, la mia risposta è questa: prima di tutto, viviamo in un universo assolutamente finito, se non nello spazio, sicuramente nel tempo, e settecento milioni di anni equivalgono al primo tiro soltanto, in un tempo "infinito".


Secondo la teoria dell'universo inflazionario ci possono essere infiniti universi. Inoltre non è detto che il nostro universo si sia formato una volta sola.

Per quanto riguarda il povero turco, non solo ha le idee molto confuse sulle proteine (ignora modularità, ridondanza, selezione molecolare, origine comune delle proteine...), ma cerca di fare una cosa impossibile: non si può descrivere un sistema caotico con il calcolo delle probabilità. I sistemi caotici sono per definizione imprevedibili.

nottrz
Inviato: 13/8/2007 12:12  Aggiornato: 13/8/2007 13:31
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
slump:
a proposito del brodo primordiale puoi dare un'occhiata agli studi sull'auto-organizzazione, vita artificiale, chimica artificiale, automi cellulari, algoritmi genetici (tutti molto legati tra loro).

Mentre per forme di "lamarkismo" ti cito di nuovo questo link (Buiatti, piante) e, come spunto di riflessione, il fenomeno della fagocitosi descritto da olah :) in uno dei primi post. Negli organismi piu' semplici, olah nel caso correggimi, il meccanismo di replicazione penso fosse abbastanza rozzo/miope e quindi potesse andare ad agganciare pezzi estranei.
Nel frattempo cercando info su Buiatti ho trovato questo link che mi sembra interessante

http://www.scienzaesperienza.it/news/new.php?id=0026

Nel frattempo pero' sottolineo di nuovo che gli algoritmi genetici, dove di certo non c'e' nessun lamarkismo esplicito, continuano a funzionare perfettamente alla faccia di tutte le presunte impossibilita' statistiche/logiche.

Massimo:
Il mio discorso e' differente da quello che riporti, infatti nel mio discorso non compaiono tempi infiniti o numerose estrazioni, ma una singola estrazione sul solo pianeta Terra.

La mia tesi e' che l'uso che viene fatto del calcolo delle probabilita' sia sbagliato. Qual'e' la probabilita' di indovinare che carta verra' estratta prima che venga estratta? 1 su 52. E dopo che e' stata estratta? 1 su 1. In pratica viene commesso lo stesso tipo di errore, si confonde il prima e il dopo l'estrazione.

La proteina di cui si parla non ha nulla di speciale se non il fatto di essere stata estratta.

Se quindi quella proteina non ha nulla di speciale e' assurdo dire che ha poca probabilita' di essersi formata. Io penso che su questo non possano esserci dubbi.
Da questo seguono gli altri calcoli che di conseguenza sono da rivedere.

Secondo me quello di cui bisognerebbe davvero calcolare la probabilita' e' il fatto che una serie di molecole varie siano venute a contatto e si siano messe a funzionare cosi' bene in concerto.
Il punto e', e qui c'e' un altro uso improprio delle probabilita': come si fa a calcolare quella probabilita'.

La probabilita' e' il rapporto tra il numero di eventi attesi e il numero di eventi possibili e la si misura sempre e solo empiricamente. Solo che qui noi non sappiamo quanti fossero gli eventi possibili, perche' non abbiamo a disposizione tanti mondi su cui sperimentare.
In senso stretto avendo avuto un solo caso in esame ed essendoci vita su questo dovremmo dedurne un 100% di probabilita'.

I calcoli empirici fatti su alcuni specifici casi li si generalizza poi su casi _supposti_ simili. Nessuno ha testato la mia bustina della tombola ma suppongo che estragga i numeri in modo ragionevolmente simile a quello atteso.
Nel caso della vita qual'e' il nostro punto di partenza? Alcuni esperimenti fatti da alcuni ricercatori? Si tratta in pratica di dire: visto che io uomo non sono in grado di riprodurre quella cosa o anche solo di capirla bene allora deve essere veramente difficile anche per la natura.
Questo e' perlomeno un po' arrogante come punto di vista.

Oltre a questo discorso strettamente numerico/formale si aggiunge il fatto che le proteine venute in contatto ai tempi non erano quelle attuali.
Inoltre il fatto che non e' vero che quella proteina debba essere al 100% cosi' ma possano esserci numerosissime alternative ugualmente valide.
Numericamente la cosa e' rilevante: le combinazioni di 200 elementi sono tante, ma se dico che sono solo 100 quelli significativi allora il numero crolla vertiginosamente (e' evidente anche senza fare conti che le combinazioni di 100 elementi sono infinitamente meno di quelle di 200).

Inoltre quella proteina non e' stata estratta in modo casuale ma per la sue specifiche caratteristiche.
Chiariamo di nuovo questo punto: l'evoluzione non lavora a caso. Quella proteina, o meglio il suo antenato, e' stata scelta per le sue caratteristiche chimiche. Nel senso che e' stata "incontrata" _per caso_ ma e' risultata _utile_ all'organismo con cui e' venuta in contatto e quindi e' rimasta.

Forse riesco a sintetizzare bene il punto del mio discorso:
Quello che dovrei chiedermi e' quante fossero le probabilita' che quella proteina, nel momento in cui e' stata "incontrata" dal mio organismo, fosse utile a sviluppare una _qualunque_ funzionalita' utile a quell'organismo (anche la funzionalita' non era prefissata).
Ma meglio ancora dovrei chiedermi quante fossero le probabilita' che una _qualunque_ proteina, nel momento in cui e' stata "incontrata" dal mio organismo, fosse utile a sviluppare una _qualunque_ funzionalita' utile a quell'organismo.

Questa e' le vera stima da fare.

Un grosso problema nel fare questa stima sarebbe definire che cosa sia una "funzionalita' utile". L'utilita' e' legata all'ambiente specifico in cui si trova l'organismo. Una mutazione che produca una nuova proteina che renda piu' veloce il mio organismo non e' necessariamente utile. E poi penso sia oggettivamente difficile quantificare il numero di funzionalita' possibili visto che queste possono andare in moltissime direzioni diverse: colore, forma, dimensioni, sensibilita' alle sostanze chimiche, e questo per ognuna delle singole parti dell' organismo.

Riassumento secondo me quei calcoli sono in alcuni casi errati (non numericamente ma logicamente) e in altri casi hanno errori di fondo (ad esempio quelli evidenziati da olah che qui riporto). Insomma, il tutto e' comunque molto ingenuo e approssimativo, di fatto ipotizza che gli esseri umani siano saltati fuori gia' completi da una grande lotteria quando penso sia evidente, almeno per me, che non e' andata cosi.

[AGGIUNTO]

Citazione:

Mentre l’organismo umano è una complessità interindipendente (non ho i termini giusti, sforzatevi di capirmi), nel senso che basta che un ormone non funzioni e l’intero meccanismo muore.


Questo non e' vero. Se una parte non funziona l'organismo si ammala non muore. Alcune parti sono fondamentali, molte altre no.
Non siamo un castello di carte. Il fatto che il nostro organismo riesca per lungo tempo, a volte indefinitamente, a resistere a malattie dei tipi piu' vari lo dimostra.
Oppure il fatto che una essere umano possa sopravvivere anche senza il pancreas, che di ormoni ne produce ben piu' di uno. E il pancreas e' solo un esempio tra tanti (stomaco, duodeno, colecisti, ecc.).
E stiamo parlando di interi organi, non di un singolo ormone.
Poi ribadisco che invece _alcune_ parti sono fondamentali.
[AGGIUNTA BIS]
Scusate, sono stato frettoloso. E ovvio che, nel caso del puncreas ad esempio, molte delle sostanze prodotte vengono reintegrate tramite farmaci. Penso che pero' questo non invalidi completamente l'argomento a favore della robustezza del nostro organismo. Penso, atto di fede, che un medico sarebbe in grado di trovare esempi piu' significativi.

Citazione:

Questo significa che la sequenza “tutto testa” è necessariamente l’unica accettabile, e riporta quindi il problema all’impossibilità statistica che io vado sostenendo dall’inizio.


Sono stati citati diversi esempi, es. emoglobina, che mostrano che la sequenza tutto testa non e' l'unica possibile.

Citazione:

(Un’altra forma di vita non sembra possibile, nello “stesso universo”, a causa di questa complessità “interindipendente”).


Innanzi tutto ci sarebbe da definire che cosa si intende con "vita", ma lasciando da parte questo tema questa frase mi sembra un po' buttata li'.

Citazione:

(Anche accettando la possibilità che la serie “tutto testa” non sia l’unica accettabile, staremmo parlando di un numero di variabili infinitamente basso rispetto alle possibilità totali di combinazione).


Mi sembra un po' sbrigativo come discorso. Come dicevo sopra la differenza tra 200! e 100! (uso il fattoriale come esempio) e' abissale.
(lasciando fa parte il fatto che l'intero discorso statistico secondo me e' fallato).

Anonimo
Inviato: 13/8/2007 12:58  Aggiornato: 13/8/2007 13:30
 Re: Gli anelli mancanti continuano ad aumentare
Boh, mi sa che continuiamo a girare intorno ad un punto inutile.

Massimo che continua a tirar fuori la probabilità bassissima che un certa successione di aminoacidi possa causalmente essersi messa in ordine per benino.

E noi qui a dire che NON è vero!

Il povero Nottrz sta scrivendo le stesse cose in 7 modi diversi per cercare di far capire che non si può partire dal risultato e dire "No, è troppo difficile". Anche Olah cerca di dirvi la stessa cosa.

NON esiste un'unica sequenza possibilie di aminoacidi perché una proteina funzioni.

Io, nel mio piccolissimo a questo punto, ho tirato in ballo l'emoglobina, ma sono stato tacciato di troppo tecnicismo e mi è stato dato dell'Attivissimo perché mi attacco al particolare.

Ma se un Turco dice una stupidaggine è tecnicismo dire che sta sbagliando?

Non solo i punti salienti per far funzianre una proteina sono pochi ma quello che nottrz sta sgolandosi per dire è che si è partiti da modelli molto ma molto più semplici, per poi arrivare alle proteine attuali. La proto-emoglobina poteva esistere tranquillamente in 3000 configurazioni completamente diverse ma tutte atte allo scopo dell'epoca. Poi, man mano, quelle meno efficaci sono state superate.

Anche attualmente, ripeto, ognuno di noi ha l'emoglobina diversa dall'altro. E, se stiamo scrivendo qui, mi sa che forse riusciamo a trasportare efficemente l'ossigeno.

Quindi NON è vero che la mutazione casuale porti necessariamente alla morte, come Olah ha cercato di dimostravi portandovi svariati esempi.

Poi, sempre Nottrz (ormai un baluardo), vi ha spiegato che, andando avanti con l'evoluzione, le mutazioni utili decrescono vertiginosamente, portandovi l'esempio della cima del monte.

Perché mai un moscerino, che è un organismo perfettamente evoluto per il compito che in natura gli spetta, dovrebbe evolversi ancora?
Se ha già raggiunto la vetta più alta della SUA catena montuosa, dove mai potrebbe arrivare, se non cadere più in basso?
Perché dovrebbe uscire un fuori un altro enzima utile, utile a che?

Poi, a fare orecchi da mercante son bravi tutti. Ma non è certo così che una discussione riesce ad evolvere.

E qui sì Attivissimo docet.

---AGGIUNTA---

Ecco un estratto dal bellissimo scritto di Buiatti linkato da Nottrz nel commento precedente.

"(...) si è scoperto, in procarioti prima in noi eucarioti poi, che i geni, le stringhe di DNA cosiddette codificanti perché portano, in codice, le informazioni per le proteine, sono ambigui. Si è infatti dimostrato che un gene è in realtà come una frase fatta di più parole che può essere letto a cominciare da un punto o da un altro e finendo dopo numeri diversi di parole. Questo porta a significati diversi della frase e cioè alla sintesi di proteine diverse con funzioni diverse. Non solo, ma negli eucarioti, le parole (esoni) sono intervallate da pezzi di DNA (introni) che non verranno poi tradotti in proteine. Anche così il DNA viene trascritto fedelmente in RNA. Questo però viene poi tagliato alle giunzioni fra introni ed esoni. Gli esoni vengono poi spesso assemblati in ordini diversi dando di nuovo proteine diverse con diverse funzioni. Per dare una idea dell'importanza di questo fenomeno posso citare il caso di una classe di proteine, le neurexine. Ebbene, di queste proteine, essenziali per la corretta trasmissione di messaggi fra neuroni, se ne conoscono più di mille probabilmente perché il cervello deve essere fornito di strumenti molto versatili, ma sono tutte codificate da solo tre geni E le fonti di ambiguità non sono solo quelle che intervengono nella trasmissione del messaggio da DNA a proteine. Queste, infatti, possono essere ulteriormente riarrangiate acquistando funzioni diverse anche dopo essere state sintetizzate."

olah
Inviato: 13/8/2007 13:46  Aggiornato: 13/8/2007 13:46
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Negli organismi piu' semplici, olah nel caso correggimi, il meccanismo di replicazione penso fosse abbastanza rozzo/miope e quindi potesse andare ad agganciare pezzi estranei.


Verissimo.

Non solo, la trasmissione orizzontale di geni è decisamente molto comune. Probabilmente ciascuno di noi ha del codice virale. Il 90% delle persone adulte, ad esempio, integra nel proprio genoma il DNA di un virus adeno associato (tranquilli, è quasi sempre innoquo...).

slump
Inviato: 13/8/2007 14:56  Aggiornato: 13/8/2007 14:56
Ho qualche dubbio
Iscritto: 8/6/2006
Da:
Inviati: 199
 Re: Gli anelli mancanti continuano ad aumentare
@ REDAZIONE

Riguardo al disaccordo con te ho dimenticato però di dire che sono perfettamente d'accordo sul fatto che il 9/11 del 2001 non sia andato affatto come la vulgata dei media ci ha sempre raccontato in merito ai responsabili veri di quella strage. Ho innumerevoli dubbi non tanto sui fatti accaduti ma sul chi, come, perché ecc. Ma non dubito che ci sia molto altro di sostanzioso da scoprire.

Il disaccordo invece è su quasi tutti gli altri argomenti compreso questo dell'origine della vita...

Tornando a questo e alle famose "probabilità" non vorrei esser stato frainteso per aver cercato di esemplificare troppo proprio con l'esempio del libro che può essere effettivamente fuorviante: quello che volevo dire è che il ragionamento probabilistico a posteriori che facciamo non ha senso, come ha già detto qualche altro dei commentatori, non ha senso proprio perché parte da un punto di vista posteriore e finalistico e, soprattutto, ignorando di fatto il numero di "tentativi" effettuati su scala universale per giungere a ciò che sembra altamente improbabile. Ma già la parola "tentativo" è sbagliata, non c'è nessuno che "tenta", è solo un cieco macinare del caso. Come la scimmietta, diciamo.

Cosa vuol dire infatti "probabilità"? La possibilità che una cosa avvenga in un determinato range di altre possibilità. Estrarre per caso l'asso di denari da un normale mazzo di carte da briscola ha una probabilità di 1/40. Anche se io ripeto 10^9 volte l'estrazione di una carta dal mazzo completo ogni volta la probabilità di estrarre l'asso di denari è 1/40. Ciò nonostante se 10^9 persone estraggono una carta dal loro mazzo per una volta, in un momento temporale qualsiasi, è praticamente certo che uno di loro estragga l'asso di denari con quell'unico tentativo (più persone è probabile). Colui che estrae l'asso di denari dal mazzo si riterrà molto fortunato di averlo preso (mettiamo che ci sia in palio un premio) e se magari è religioso dirà che, viste le probabilità sfavorevoli, è stato Dio a dargli una mano. Se colui che estrae l'asso di denari dal mazzo pensasse di essere stato l'unico al mondo a provare a prendere una carta allora la sua religiosità aumenterebbe a dismisura...

Il problema con le "probabilità" è un problema di delimitazione spaziale e temporale, cioè di conoscenza. Io, in questo momento ho 1/40 di possibilità di estrarre l'asso di denari con un solo tentativo e per ogni mio futuro tentativo: ogni persona tra un miliardo di persone che facesse ora o tra poco o domani il mio tentativo avrebbe la mia stessa bassa probabilità di successo eppure siamo praticamente certi che uno o più di loro estrarrà la carta giusta. Diciamo che è la legge dei grandi numeri.

A differenza dell'esempio delle carte, con la "vita" io, noi, non sappiamo se e per quante volte su quanti pianeti ci sono state le possibilità materiali (diciamo il "brodo primordiale" per semplificare) perché si formasse una vita simile: se fossero un numero enormemente elevato allora il fatto che la vita si sia formata casualmente, anche una sola volta, (qui sulla Terra) non sarebbe niente di eccezionale, anzi sarebbe statisticamente preventivabile. Adesso ci meravigliamo solo che il biglietto vincente l'abbiamo estratto noi: ma a qualcuno da qualche parte doveva capitare! Se fosse vera la teoria dell'universo che si espande, collassa, riespande ecc. per un numero senza fine di cicli allora le probabilità della vita diventano una certezza pur a partire da una assoluta casualità. Se questo universo fosse invece unico e finito allora bisognerebbe fare qualche "conto" che io francamente non sono capace di fare adesso non avendo idea di quanti pianeti dell'universo avrebbero potuto far nascere la vita (pur non facendolo per l'alta improbabilità dell'evento).

Le nostre conoscenze sull'universo (oltre che sulla biologia) sono ancora troppo scarse per toglierci il dubbio, di certo però si tratta di un dubbio che ammette una o più soluzioni "materialistiche" e fino a che non vengono sicuramente escluse io credo sia sciocco tirare in ballo Dio, anche dal punto di vista del "credente" (sarà stato Dio a mescolare a modo suo gli aminoacidi nel pentolone primordiale?) Infatti i "creazionisti" o qualunque loro variante, come quelli del "progetto intelligente", come giustificano un progetto che sarà anche intelligente ma che ha anche notevoli falle, guasti e imperfezioni? Non solo "moralmente" ma anche materialmente? Ricadiamo cioè in piena teologia. Ed anzi più la spiegazione creazionista è semplice e letterale e si avvicina al racconto biblico e meno problemi ha poiché può spiegare qualunque problema che sorga con una qualche "volontà di Dio" (perlopiù imperscrutabile).

Secondo me invece ciò che è, anche probabilisticamente, più difficile spiegare è come si sia passati dal singolo protoorganismo unicellulare all'uomo attuale in un tempo tutto sommato non troppo lungo (500/600 milioni di anni si dice) e solo attraverso mutazioni assolutamente casuali: qui credo sia necessario ammettere una qualche forma di controllo o indirizzo a livello genetico delle mutazioni possibili. E ringrazio chi mi ha segnalato vari link ad argomenti che potrebbero spiegare il problema.

"In powerful rain, they laid down their heads to die"
(My Dying Bride)
Oldboy
Inviato: 13/8/2007 15:07  Aggiornato: 13/8/2007 16:51
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Ciao, shevek. Grazie per l'augurio!

Purtroppo per gli evoluzionisti, le più recenti scoperte sul DNA sono l'ennesima tegola sulla loro fantasiosa teoria.

Come dice il genetista James Shapiro, infatti, il DNA dispone di "meccanismi di autocorrezione per rimuovere gli errori che inevitabilmente avvengono durante la replicazione del DNA stesso".

E' un meccanismo di "correzione tipografica" simile a quello dei sistemi di scrittura computerizzata.

Questo rende ancora più improbabili le fantasticherie dell'evoluzionismo, perché il DNA si difende da quelle "mutazioni casuali" che sarebbero alla base dell'evoluzione.
Il DNA è stabile, molto più di quello che si pensava: è forse la struttura più stabile dell'universo.

Quando il DNA non riesce a difendersi dalle mutazioni, l'individuo non diventa "più adatto a sopravvivere", ma viene colpito da malattie genetiche e infermità.
(Questo e molti altri problemi sono trattati ne "L'uccellosauro e altri animali", di Maurizio Blondet, Effedieffe editore.)

D'altronde, come poteva Darwin prevedere tutto questo, un secolo e mezzo fa?
Ovviamente sir Charles non sapeva un beneamata né di cellule, né di DNA...

Oldboy
Inviato: 13/8/2007 15:40  Aggiornato: 13/8/2007 15:42
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Ma gli stessi presunti meccanismi dell'evoluzione non sono mai stati dimostrati, verificati e riprodotti.

(La scusa è che si tratta di "fenomeni lunghi", come diceva olah.
Già, molto scientifico definire "lungo" un fenomeno che è ancora tutto da dimostrare, e che nessuno ha mai osservato...
Per quello che ne sappiamo, potrebbe anche essere un "fenomeno breve".
Le prove sono le stesse: nessuna.)

In natura non esistono meccanismi in grado di trasformare una specie in un'altra.
(O almeno non sono mai stati individuati, il che sul piano scientifico è esattamente la stessa cosa.)

Che i pesci si siano evoluti nei rettili, questi negli uccelli e così via resta una fantasiosa ipotesi, spiegabile con l'arretratezza delle conoscenze scientifiche all'epoca di Darwin.

D'altronde, Darwin riteneva plausibile che le balene derivassero da una razza di orsi che, un bel giorno, traslocarono nel mare, trasformandosi così in cetacei...
Roba da ridere, certo, ma forse il passaggio dal pesce al rettile è più credibile?
E quello dai rettili agli uccelli?...

astro
Inviato: 13/8/2007 15:53  Aggiornato: 13/8/2007 15:54
Ho qualche dubbio
Iscritto: 3/6/2006
Da:
Inviati: 233
 Re: Gli anelli mancanti continuano ad aumentare
ma l'argumentum ad nauseam si può usare?


Se lo leggo altre 100 volte mi convinco anch'io che il DNA è stabile e che non è possibile avere evidenze del neodarwinismo.


Si può avere uno smile che sbadiglia?



EDIT: finito il corso di statistica qualche anima buona ha intenzione anche di iniziarne uno di biologia molecolare?

Anonimo
Inviato: 13/8/2007 16:09  Aggiornato: 13/8/2007 16:09
 Re: Gli anelli mancanti continuano ad aumentare
Oldboy, ma sbaglio o hai riscritto la stessa identica, inutile ed errata cosa di qualche commento fa?

Mi sa che ha ragione Astro, forse prima di parlare, un po' studiare bisognerebbe... Piuttosto che citare biologi a caso che dicono quello che noi pensiamo.

Astro: questa serie di ripetizioni infinite di cose sbagliate mi ricorda un post sulle schie chimiche, chissà dove mai l'avrò letto.

Oldboy
Inviato: 13/8/2007 16:15  Aggiornato: 13/8/2007 16:15
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Morfeo,
leggi meglio i messaggi precedenti.

Ho citato - di nuovo - la stabiltà del DNA solo perché shevek mi ha chiesto di dargli un riferimento più preciso al proposito.
Cosa che, per educazione, ho fatto.

Mi duole aver turbato la tua squisita sensibilità con i miei deprecabili messaggi.
Me ne scuso, ma permettimi un consiglio: ti basterà non leggerli, e il mondo ti sorriderà.

Anonimo
Inviato: 13/8/2007 17:29  Aggiornato: 13/8/2007 17:29
 Re: Gli anelli mancanti continuano ad aumentare
...e proprio perché li ho letti mi sono accorto che quando parli del meccanismo di autocorrezione usi le stesse parole.

Un riferimento più preciso forse significa altre prove a sostegno di un tale fatto.

Non sei deprecabile, e non eviterò di leggerti, solo stai riferendo cose non esattamente corrispondenti alla realtà.

Se tu citi le parole di un altro, mentre qui dentro c'è chi evidentemente queste cose le studia e ti dice che non è così, beh, forse un minimo dubbio dovrebbe sorgere.

Oldboy
Inviato: 13/8/2007 18:08  Aggiornato: 13/8/2007 18:08
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Morfeo,

shevek mi chiedeva chi fosse lo studioso che sottolinea la - sorprendente - stabilità del DNA.
Io glielo ho indicato: è James Shapiro, biochimico dell'università di Chicago.

E ho indicato il testo che spiega la questione: "L'uccellosauro e altri animali", di Maurizio Blondet.

Penso che siano indicazioni utili.
Anche perché Shapiro, pur non essendo un creazionista, parla in modo molto esplicito di quanto gli evoluzionisti si sbaglino, a proposito delle presunte "mutazioni casuali" che sarebbero alla base dell'evoluzione.

Secondo lui, il DNA funziona in modo tale da proteggersi - con grande efficacia - dalle mutazioni.

P.S.
Sono lusingato di non essere "deprecabile", comunque...

Refrattario
Inviato: 13/8/2007 18:35  Aggiornato: 13/8/2007 18:35
Ho qualche dubbio
Iscritto: 20/7/2004
Da: Limbo
Inviati: 115
 Re: Gli anelli mancanti continuano ad aumentare
Scusate ma in un universo infinito e di conseguenza tempo infinito se c'è un evento che ha 1 probabilità contro 1 alla ... (mettete voi l'elevazione) è sicuramente già avvenuto perchè 1 alla ...(idem come sopra) è più piccolo di infinito.

Per i fautori del universo finito lo spazio è il tempo sono così grandi che si può considerare simile a infinito (strano che si focalizzi il dibattito degli scienziati e non, più non, sull'evoluzionismo e invece il bigban si consideri un dato di fatto).

Comunque la diatriba evoluzionismo anti-evoluzionismo è tutto (politica, religiosa, economica, filosofica etc..) fuorchè scientifica.

Il discorso che si vuole arrivare è se l'uomo è al centro dell'universo.

Redazione
Inviato: 13/8/2007 19:32  Aggiornato: 13/8/2007 19:39
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
NOTTRZ: Citazione:
La proteina di cui si parla non ha nulla di speciale se non il fatto di essere stata estratta. Se quindi quella proteina non ha nulla di speciale e' assurdo dire che ha poca probabilita' di essersi formata. Io penso che su questo non possano esserci dubbi.


Allora, qui bisogna che ci chiariamo una volta per tutte, se no davvero giriamo in tondo. Il turco malefico mi dice che c’è un solo ordine valido di aminoacidi per ciascuna proteina. A sentire te invece una poteina esce comunque, come un qualunque numero esce all’estrazione del Lotto. Se non è questa è quell’altra.

Morfeo aggiunge che l’emoglobina può avere sequenze differenti. Ma le altre? Quanto cacchio sono ‘ste proteine, prima di tutto, e quante di queste sono formate da una sequenza unica degli aminoacidi che la compongono?

(Siate onesti però, e non approfittatevi del fatto che io di chimica non so una mazza).

°°°

MORFEO scusami, ero leggermente inacidito, in quel momento, ma non da te.

nottrz
Inviato: 13/8/2007 19:40  Aggiornato: 13/8/2007 19:40
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
slump
Citazione:

Se questo universo fosse invece unico e finito allora bisognerebbe fare qualche "conto" che io francamente non sono capace di fare adesso non avendo idea di quanti pianeti dell'universo avrebbero potuto far nascere la vita (pur non facendolo per l'alta improbabilità dell'evento).


Un punto di partenza per questo tipo di calcolo puo' essere l'equazione di Drake (la versione in inglese al solito e' molto piu' completa).
Una cosa che trovo interessante, e che condivido appieno, e' il valore scelto da Drake per fl, cioe' le probabilita' che si sviluppi la vita su un pianeta su cui sono presenti le condizioni necessarie al suo sviluppo: 100%.
Sospetto pero' che il suo sia stato un approccio puramente statistico: conosciamo un solo pianeta, c'e' vita quindi 100%.

Due ricercatori hanno recentemente ricalcolato il valore come 13%, qui c'e' l'articolo con i dettagli.
Nell'articolo lasciano aperta la questione del meccanismo esatto che abbia portato alla comparsa della vita e si preoccupano solo di analizzare la rapidita' con cui cio' sia avvenuto non appena le condizioni fisiche si ritiene lo abbiano permesso.

Stavo per scartare l'articolo pensando che in fondo fosse palesemente di parte, ma invece mi sono chiesto: se c'e' questo "design intelligente" che ha operato sulla Terra facendoci comparire, per quale motivo non dovrebbe aver operato anche su Marte o su qualunque altro pianeta?

Refrattario
Citazione:

Per i fautori del universo finito lo spazio è il tempo sono così grandi che si può considerare simile a infinito (strano che si focalizzi il dibattito degli scienziati e non, più non, sull'evoluzionismo e invece il bigban si consideri un dato di fatto).


Attualmente si ritiene che l'universo sia finito e che abbia 15/20 miliardi di anni.
L'idea del big bang e' saltata fuori dalle equazioni della relativita' generale, dal red shift delle galassie, dalla radiazione cosmica di fondo e sicuramente da un po' di altri elementi che non so. Il big bang concorda abbastanza bene con queste cose ma ha anche lui un po' di magagne ed e' gia' stato rattoppato alcune volte.
Semplicemente al momento non ci sono modelli piu' convincenti.

Redazione
Inviato: 13/8/2007 19:46  Aggiornato: 13/8/2007 19:47
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
SLUMP: Per quel che riguarda i moventi / i responsabili, aspetta “La Verità di Cristallo”.

Citazione:
quello che volevo dire è che il ragionamento probabilistico a posteriori che facciamo non ha senso, come ha già detto qualche altro dei commentatori, non ha senso proprio perché parte da un punto di vista posteriore e finalistico
Perchè non dovrebbe avere senso, scusa? Quando diciamo che non è possibile che quattro persone che non hanno mai guidato un jet nella loro vita abbiano fatto le acrobazie viste fare agli aerei del 9/11, non facciamo un ragionamento probabilistico a posteriori? Perchè questo è accettabile, e l’altro no?

Citazione:
e, soprattutto, ignorando di fatto il numero di "tentativi" effettuati su scala universale per giungere a ciò che sembra altamente improbabile. Ma già la parola "tentativo" è sbagliata, non c'è nessuno che "tenta", è solo un cieco macinare del caso.
Allora mi dài ragione: se nessuno “tenta”, le probabilità si riducono a quelle di vedere un Boeing formarsi per caso da un deposito di rottami.

ELFLACO
Inviato: 13/8/2007 19:52  Aggiornato: 13/8/2007 19:52
Dubito ormai di tutto
Iscritto: 28/10/2005
Da:
Inviati: 1839
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Attualmente si ritiene che l'universo sia finito e che abbia 15/20 miliardi di anni.
L'idea del big bang e' saltata fuori dalle equazioni della relativita' generale, dal red shift delle galassie, dalla radiazione cosmica di fondo e sicuramente da un po' di altri elementi che non so. Il big bang concorda abbastanza bene con queste cose ma ha anche lui un po' di magagne ed e' gia' stato rattoppato alcune volte.


...e anche dal valore di una certa"costante gravitazionale" a cui viene dato un valore che dipende...,per dirlo in maniera "terra-terra"...dall'umore del astrofisico di turno!!
Una costante che viene calcolata in maniera "visuale" e che ha un errore del quasi 50 %.Ed ´lei la colpevole se ancora non siamo sicuri se l'universo è chiuso o aperto.
E anche se ci mettiamo d'accordo se sia aperto o chiuso manca ancora il 90% della materia necessaria...

AAAAh si la materia oscura!!sisi

“Le persone non dovrebbero avere paura dei propri governi, sono i governi a dover aver paura delle persone.”
olah
Inviato: 13/8/2007 19:58  Aggiornato: 13/8/2007 20:01
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Il fatto che qualcuno (Oldboy) citi James Shapiro, una persona seria, per fargli dire certe sciocchezze grida vendetta.

Questo lo scrive James Shapiro:

Citazione:
In the last 50 years, molecular genetics has revealed features of DNA sequence organization, protein structure and cellular processes of genetic change that suggest evolution by natural genetic engineering. Genomes are hierarchically organized as systems assembled from DNA modules, which themselves generally constitute systems at lower levels. Each genome is formatted and integrated by sequence elements that do not code for proteins. These formatting elements constitute codons in multiple genetic codes for distinct functions such as transcription, replication, DNA compaction and genome distribution to daughter cells. Consequently, the genome has a computational system architecture. Proteins are systems composed of functionally distinct domains connected in polypeptide chains. Whole-genome sequencing indicates that rearrangement of genetic modules plus duplication and reuse of existing genomic systems are fundamental events in evolution. Studies of genetic change show that cells possess mobile genetic elements and other natural genetic engineering activities to carry out the necessary DNA reorganizations. Natural genetic engineering functions are sensitive to biological inputs, and their non-random operations help explain how novel system architectures can arise in evolution.


Articolo di riferimento: http://shapiro.bsd.uchicago.edu/21st_Cent_View_Evol.html

Lo stesso shapiro ha scoperto che un protozoo sottoposto a stress può tagliuzzare (scusate il termine tecnico) il suo DNA in tanti piccoli pezzettini e ricombinarli acquisendo nuovi fenotipi per adattarsi all'ambiente.

La realtà ragazzi (e ragazze, spero) è che più impariamo sulla biologia molecolare e più ci accorgiamo di quanto i sistemi biologici siano dinamici. E' un continuo taglia e cuci di DNA, ci sono continue ricombinazioni a tutti i livelli. Le cose ci possono sembrare statiche perché le singole modifiche possono apparire impercettibili, in una scala temporale ristretta, ma sotto sotto, nella biosfera, in ogni scala, c'è sempre un gran fermento.

olah
Inviato: 13/8/2007 20:13  Aggiornato: 13/8/2007 20:14
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Quanto cacchio sono ‘ste proteine, prima di tutto, e quante di queste sono formate da una sequenza unica degli aminoacidi che la compongono?


L'articolo segnalato da nottrz ( http://www.scienzaesperienza.it/news/new.php?id=0026 ) è ben scritto e può esserti d'aiuto.

Non so quanto siano le proteine, ma posso dirti che per quanto riguarda le sequenze è meglio ragionare in termini di domini funzionali. Alcuni domini sono molto variabili, altri sono molto conservativi. in genere comunque le sequenze che non cambiano mai sono abbastanza brevi.

cherubino
Inviato: 13/8/2007 20:27  Aggiornato: 13/8/2007 20:27
Mi sento vacillare
Iscritto: 1/6/2006
Da: Haute-Normandie
Inviati: 430
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
dalle impossibilità statistiche delle prime formazioni di aminoacidi, nello stagno primordiale, alla troppo geniale “invenzione” del DNA/RNA, fino al caos più totale nella transizione da primate a uomo,


mmm... ho visto che si è in tema di film e libri... consiglio:
1) Jacques Monod, "il caso e la necessità", classici (ssimi) Mondadori
2) Christian de Duve, polvere vitale, TEA
Quest'ultimo autore ho conosciuto recentemente di persona, è un intrepido vegliardo che ha visto la biologia molecolare nascere (forse era anche tra gli ostetrici), crescere e riprodursi.
Potrebbero essere due letture chiarificatrici, prima di iniziare le discussioni.
Saluti

nessuno
Inviato: 13/8/2007 20:30  Aggiornato: 13/8/2007 20:30
Mi sento vacillare
Iscritto: 30/7/2005
Da: Albino (BG) - Bassa Valle Seriana
Inviati: 501
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Perchè non dovrebbe avere senso, scusa?


Mi prendo l''impegno di tradurlo e postarlo. Ma Mazzucco non dovrebbe avere problemi di comprensione dell'inglese

Problems with the creationists' "it's so improbable" calculations

1) They calculate the probability of the formation of a "modern" protein, or even a complete bacterium with all "modern" proteins, by random events. This is not the abiogenesis theory at all.

2) They assume that there is a fixed number of proteins, with fixed sequences for each protein, that are required for life.

3) They calculate the probability of sequential trials, rather than simultaneous trials.

4) They misunderstand what is meant by a probability calculation.

5) They seriously underestimate the number of functional enzymes/ribozymes present in a group of random sequences.

I will try and walk people through these various errors, and show why it is not possible to do a "probability of abiogenesis" calculation in any meaningful way.

Buona vita

Guglielmo

"Quieremos organizar lo entusiasmo, no la obediencia" - Buenaventura Durruti
Refrattario
Inviato: 13/8/2007 21:30  Aggiornato: 13/8/2007 21:30
Ho qualche dubbio
Iscritto: 20/7/2004
Da: Limbo
Inviati: 115
 Re: Gli anelli mancanti continuano ad aumentare
nottrz dice:

<
Semplicemente al momento non ci sono modelli piu' convincenti.(modelli cosmologici)
>

dovresti togliere il più, non ci sono modelli cosmologici convincenti al momento. (siamo in ot)


Redazione dice:

<
Quanto cacchio sono ‘ste proteine, prima di tutto, e quante di queste sono formate da una sequenza unica degli aminoacidi che la compongono?
>

cito da A.L. Lehninger "Biochimica"

<
Nell'organismo umano, per esempio, ci può essere qualcosa come 5 milioni di tipi diversi di proteine, in confronto alle 3000 circa del'E.coli(batterio).
Delle molecole proteiche di E.coli nessuna è identica a una qualsiasi delle proteine trovate nell'uomo, anche se alcune funzionano abbastanza simile.
Infatti, ogni specie di organismo ha un suo corredoben distinto, da un punto di vista chimico, di molecole proteiche e di acidi nucleici.
Poichè probabilmente vi sono oltre 1.200.000 specie di organismi viventi,...si può calcolare che le specie viventi, nel loro complesso, devono contenere tra 10¹° e 12¹² tipi diversi di molecole proteiche e circa 10¹° acidi nucleici
>

nottrz
Inviato: 13/8/2007 22:07  Aggiornato: 13/8/2007 22:07
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Massimo:
Citazione:
Perchè non dovrebbe avere senso, scusa? Quando diciamo che non è possibile che quattro persone che non hanno mai guidato un jet nella loro vita abbiano fatto le acrobazie viste fare agli aerei del 9/11, non facciamo un ragionamento probabilistico a posteriori? Perchè questo è accettabile, e l’altro no?


Ho fatto un bel po' di fatica a trovare la motivazione in modo esplicito, spero di esserci riuscito, ma qualche dubbio ancora mi rimane.
Provo a raccontarla.

Il mio attentatore si sveglia la mattina e decide che vuole schiantare un aereo contro una delle torri gemelle. Esce di casa, compra il biglietto, dirotta l'aereo e lo schianta sulla torre nord. Pressapoco la versione ufficiale ;)

Adesso ci chiediamo che probabilita' avesse di riuscire nella sua impresa.

Uscire di casa: facile, 99,999 %
Comprare biglietto: facile, 99,999 %
Dirottare aereo: sappiamo dalla statistiche sui dirottamenti che solo 1 su, bho, 1000 vanno a buon fine. Ok, 0,1%
Schiantare aereo: guidare un aereo in modo preciso senza esperienza, sempre dalle statistiche, 0,2%

E fin qui tutto bene, dovrei moltiplicare il tutto per avere il mio risultato. Pero'...

Il dirottatore ha usato un taglierino: altro 70% rispetto alla media dei dirottamenti.
Colpire la torre nord: altro 80% perche' complica ulteriormente la manovra.

Ma chi ha detto che lui volesse colpire proprio la torre nord? Nel suo piano iniziale non c'erano preferenze.
Pero' le cose sono andate cosi',anche se lui non aveva questo vincolo. Nel nostro calcolo dobbiamo conteggiarlo?
E dobbiamo conteggiare anche il piano esatto dove si e' schiantato l'aereo? Quindi, centrare proprio il 95esimo piano: 0,6%.

L'obiettivo era veramente fissato? Magari l'attentatore di questo esempio ha scelto le torri perche' ci si e' trovato casualmente allineato. L'obiettivo avrebbe potuto essere anche un qualunque altro grattacielo.
Quindi il nostro calcolo diventerebbe: guidare aereo contro un qualunque grattacielo di NY: 0,4%.

E cosi' via.

Alcuni elementi diventano significativi solo a posteriori o, meglio, solo nel momento in cui vengono fissati.

A scanso di equivoci: non sto dicendo che le intenzioni modifichino le probabilita'. Se lancio un dado cercando di ottenere un numero pari avro' il 50% di probabilita'. Se esce 4 e qualcun'altro stima le probabilita' di quel 4 potrebbe giustamente dire che avevo 1 su 6 di ottenerlo ma non era quello il mio obiettivo, il suo calcolo parla d'altro.

Citazione:

Morfeo aggiunge che l’emoglobina può avere sequenze differenti. Ma le altre? Quanto cacchio sono ‘ste proteine, prima di tutto, e quante di queste sono formate da una sequenza unica degli aminoacidi che la compongono?


Parto da wikipedia

http://it.wikipedia.org/wiki/Proteina
http://en.wikipedia.org/wiki/Protein
http://en.wikipedia.org/wiki/Protein_domains

Di protenie immagino che in senso stretto ce ne siano infinite. Alcune probabilmente si formano piu' facilmente e sono piu' difficili da spezzare, quindi sono quelle che troviamo in giro piu' spesso.
Qui mi arrischio un po', sparatemi se le dico troppo grosse.
Penso che fondamentalmente a nessuno freghi molto della struttura primaria e secondaria di una proteina se non per il pezzetto visibile sulle parti esposte. Visto che sono dei bei gomitolazzi alla fine quello che sta nella parte nascosta conta poco, se non a determinare l'aggrovigliamento stesso che e' dato proprio dal fatto che la molecolona si lega con se stessa attorcigliandosi.

Probabilmente i domini di cui parla olah sono macro caratteristiche delle proteine. Finche' questi rimangono uguali credo si dica che la proteina e' ancora la stessa.

A proposito delle variazioni possibili su una proteina riporto qui sotto una parte dell'articolo segnalato da nessuno, che mi sembra molto interessante, anche solo per la parte introduttiva.

"There are in most proteins regions where almost any amino acid can be substituted, and other regions where conservative substitutions (where charged amino acids can be swapped with other charged amino acids, neutral for other neutral amino acids and hydrophobic amino acids for other hydrophobic amino acids) can be made. Some functionally equivalent molecules can have between 30 - 50% of their amino acids different. In fact it is possible to substitute structurally non-identical bacterial proteins for yeast proteins, and worm proteins for human proteins, and the organisms live quite happily."

Nella mia ingenuissima visione immagino le molecole tipo il gioco geomag solo che ci sono diversi tipi di calamite a seconda dei differenti legami che si possono formare (valenze, ecc.). Se ci avete mai trafficato saprete che una striscia di geomag tende ad appiccicarsi su se stessa e ad aggrovigliarsi.
Le molecole in generale fanno lo stesso, dove possono si appiccicano e quindi una grossa molecola comincia ad attorcigliarsi su se stessa cercando di soddisfare tutte le tensioni che ci sono in ballo. Dopo un po' di aggrovigliamenti si assesta su una forma di bassa tensione (in teoria minima ma...) dove piu' o meno resta bella incastrata.

Anonimo
Inviato: 13/8/2007 22:20  Aggiornato: 13/8/2007 22:20
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Redazione:Quanto cacchio sono ‘ste proteine, prima di tutto, e quante di queste sono formate da una sequenza unica degli aminoacidi che la compongono?


Le proteine esistenti in natura credo siano davvero un numero esagerato, ma il punto saliente è un altro. La sequenza di aminoacidi non è unica.

Ho tirato in ballo l'emoglobina perché è studiatissima e straconosciuta. Ed il discorso fatto è applicabile alle altre: la sequenza non deve essere strettamente univoca, l'importante è che alcune posizioni chiave siano occupate da quell'aminoacido.

Perciò dicevo che ognuno di noi qui dentro ha l'emoglobina diversa l'uno dall'altro. Sicuro abbiamo in comune gli aminoacidi nelle posizioni chiave
E non sto barando, basta un libro di biochimica per confermarti quello che ti sto dicendo.

Purtroppo il turco sarebbe bocciato all'esame di biochimica.

Credo che Nottrz voglia dire che ai primordi c'era un certo numero di proto-proteine atte a svolgere una determinata funzione, anche perché di struttura abbastanza semplice.

Quindi più configurazioni base diverse, e ciascuna di loro non univocamente determinata. Di qui poi la scrematura per passaggi successivi, fino alla complessità ed alla quasi perfezione delle strutture attuali. E sottolineo "quas"i, perché sempre parlando della nostra cara emoglobina, non è ancora perfetta, quindi si sta ancora evolvendo.

Per questo diciamo che il calcolo probabilistico è sballato, e solo di quello stiamo parlando.

Io almeno non ho alcuna intenzione di difendere a spada tratta l'evoluzionismo. Né dico che tutto sia nato dal caso.

Semplicemente non lo so e, dato il limite di astrazione del mio cervello umano, non penso proprio che potrò mai arrivare a concepirlo.

Tutto qui.

Nessuna intenzione Attivissima da parte mia.


Fabrizio70
Inviato: 13/8/2007 23:16  Aggiornato: 13/8/2007 23:16
Sono certo di non sapere
Iscritto: 18/5/2006
Da: Roma
Inviati: 3721
 Re: Gli anelli mancanti continuano ad aumentare
Complimenti a tutti per il thread , interessante e ricco di spunti , ma secondo me state dimenticando una cosa al dir poco fondamentale,ovvero la "vita" stessa ,i geni non si evolvono casualmente ma per uno scopo.
Se io prendo una manciata di sabbia e la faccio cadere non é che casualmente una volta forma un cubo , quella successiva una frittella e quella dopo ancora una ciambella con il cubo , no , "casualmente" tutte le volte formo un cono con la medesima angolazione , ci sono delle leggi fisiche per cui questo accade,sarebbe interessante sapere allora quali sono le leggi che regolano la riproduzione del dna , lo "scopo" della vita , sono millenni che se ne parla...

Il lusso non può mai essere soddisfatto perché, essendo qualcosa di falso, non esiste per esso un contrario vero e reale in grado di soddisfarlo e assorbirlo.
Wilhelm Richard Wagner-1849
Redazione
Inviato: 13/8/2007 23:44  Aggiornato: 13/8/2007 23:49
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
FABRIZIO: Infatti.

"EVOLUZIONISTI": Allora facciamo così, lo dico in modo "non scientifico" del tutto: avendo a disposizione settecento milioni di anni, e da una parte un rottamaio "enorme", dall'altra uno stagno primordiale, si assembla da solo prima un Boeing o Leonardo da Vinci?

Quello che voglio dire è che finchè si guarda alla singola proteina si può anche sostenere che ce la può fare. Ma quando consideri quello scalino il primo di una lunghissima serie, NECESSARIAMENTE ININTERROTTA E SEMPRE PIU COMPLESSA, a me semplicemente viene da ridere.

Non sarà "scientifico", ma a me basta e avanza.

PS: carini quelli che dicono "sbaglia questo, non capisce quello, dimentica di considerare quell'altro...", ma poi si dimenticano di raccontarci come sarebbero andate le cose.

Lo ripeto - e questa ricerca l'ho fatta a fondo - NON ESISTE una spiegazione completa ed esaustiva che ci racconti dettagliatamente i mille passaggi dalla prima ameba a Leonardo. Si dice semplicemente che è possibile poichè non è dimostrabile che sia impossibile.

Ma in realtà, esattamente come per il caso Kennedy, l' "ipotesi Oswald" non è nemmeno formulabile.

Oldboy
Inviato: 13/8/2007 23:50  Aggiornato: 13/8/2007 23:50
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Olah,
mi spiace che tu abbia frainteso così clamorosamente le parole di James Shapiro (che ho citato testualmente).

Quando poi affermi che io gli "faccio dire sciocchezze", comincio a dubitare della tua lealtà intellettuale.

Certo, Shapiro non è un creazionista (l'avevo precisato).
Ma proprio per questo le sue parole assumono un particolare valore, quando rileva gli errori della concezione evoluzionista.

Dice Shapiro:
"Il DNA dispone di livelli multipli di meccanismi di autocorrezione, per riconoscere e rimuovere gli errori che inevitabilmente avvengono durante la duplicazione.

Shapiro parla di "proofreading mechanisms", cioé apparati di correzione tipografica simili ai programmi di scrittura computerizzata.

"Il DNA, infatti, è più simile alla tecnologia informatica che al meccanicismo che dominava le menti quando venne formulata la teoria darwiniana".

Il succo è che il DNA si difende attivamente da tutte quelle mutazioni casuali su cui l'evoluzionismo fonda le sue ipotesi di evoluzione.

Il DNA si rivela quindi una delle strutture più stabili dell'intero universo, forse la più stabile in assoluto.
Proprio perché Shapiro è uno studioso onesto, non teme di esporre le conclusioni dei suoi studi, anche se - oggettivamente - infliggono l'ennesimo duro colpo al dogma evoluzionista.

Oldboy
Inviato: 14/8/2007 0:25  Aggiornato: 14/8/2007 4:12
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
L'esempio del Boeing che si forma per caso, citato da Mazzucco, mi ha ricordato una considerazione del matematico e astronomo Fred Hoyle.

Per quanto evoluzionista, Hoyle disse alla rivista Nature:

"La probabilità che forme di vita superiore siano pervenute all'esistenza per caso è paragonabile a quella di un tornado che, spazzando un deposito di rifiuti, riesca ad assemblare un Boeing 747 col materiale presente."

E' evidente alla ragione, e all'esperienza, che non importa quanto tempo il tornado abbia a disposizione.
Se anche avesse miliardi di anni per provarci, non riuscirà mai ad assemblare un Boeing.

Occorre una volontà intelligente, per organizzare una struttura complessa.
(Non bastano il caso e il tempo, fosse anche un tempo lunghissimo.)

E gli esseri viventi sono molto, molto più complessi di qualsiasi aereo...

Refrattario
Inviato: 14/8/2007 0:47  Aggiornato: 14/8/2007 0:47
Ho qualche dubbio
Iscritto: 20/7/2004
Da: Limbo
Inviati: 115
 Re: Gli anelli mancanti continuano ad aumentare
Redazione dice:

<
"EVOLUZIONISTI": Allora facciamo così, lo dico in modo "non scientifico" del tutto: avendo a disposizione settecento milioni di anni, e da una parte un rottamaio "enorme", dall'altra uno stagno primordiale, si assembla da solo prima un Boeing o Leonardo da Vinci?
>

non-scientifico mode on

Detta così nessuna delle due. Hai imposto delle condizioni molto ristrettive, 700.000.000 anni, 1 rottamaio, 1 brodo primordiale.

Provo una simulazione più aderente alla realtà e alle conoscenze in nostro possesso, una simulazione dell'universo.

Dati:

15 miliardi di anni, miliardi di miliardi di stelle, un po meno di stelle simile al sole, qualche milione di pianeti nelle condizioni della terra (credo di essere abbastanza restrittivo)

possibilità di trovare dei rottamai su questi pianeti molto bassa vicino allo 0

sulla terra di stagni primodiali se ne possono trovare qualcuno nel corso delle ere, moltiplicato per qualche altro pianeta simil terra che ha seguito le stesse vicissitudini del nostro pianeta, abbastanza tanti.


Analisi:
possibilità di trovare un boing belle fatto, nessuna
possibilita di incontrare Leonardo da Vinci, è successo sulla terra tra 1452 e 1519 del calendario gregoriano

non-scientifico mode off

E' più facile che un Leonardo da Vinci passi per uno stagno primordiale che un boing entri in un pentagono

Al2012
Inviato: 14/8/2007 1:43  Aggiornato: 14/8/2007 1:47
Dubito ormai di tutto
Iscritto: 25/10/2005
Da:
Inviati: 2158
 Re: Gli anelli mancanti continuano ad aumentare
Mi rendo conto di non aver nessun titolo e specializzazione specifica, sono curioso e mi pongo domande.

Cerco di mettere qualche “paletto” più o meno conficcato nel “terreno della mia ricerca”.

“Paletto”:
la parte materiale sia organica che inorganica, che compone il macromondo è solo una parte, quella più materiale e visibile. Questa parte è stata catalogata, sezionata, scomposta dall’ intelletto della umanità.

Oltre a questa c’è anche una parte “immateriale” o che è definita così solo perché non è percepibile da nostri sensi.

L’evoluzione dell’umanità vista solo dal punto di vista biologico è solo una parte, una piccola parte, della evoluzione della nostra specie, che ha sua volta è una piccolissima parte dell’evoluzione della vita.

Nel discorso puramente scientifico sia fisico che biologico, manca (a mio avviso) una visione di insieme. Manca una entità predominante ed è la “coscienza”.

A pari passo con l’evoluzione biologica possiamo verificare una corrispondente evoluzione cognitiva.

Il battere ha sicuramente una “cognizione ambientale” per esempio sa distinguere se si trova in un ambiente favorevole o meno, e porre le eventuali contro misure, l’evoluzione della cognizione ambientale procede evolvendosi insieme alla biologia complessa dell’essere biologico fino ad arrivare ad un organismo biologico complesso con la capacità cognitive complesse, e la coscienza della propria esistenza individuale.

Questo ragionamento porta ha considerare la coscienza come un effetto della complessità biologica, però c’è un problema, (per quanto so) non si sa dove mettere la coscienza, in quale organo biologico possiamo mettere di casa la coscienza ??

Il cervello ? Cervello e sistema nervoso ? Che processo chimico o elettrico produce la coscienza ?

La coscienza è può essere considerata un fenomeno chimico, biologico, elettrico ?

L'EVOLUZIONE DELLA COSCIENZA

“Capire … significa trasformare quello che è"
Anonimo
Inviato: 14/8/2007 3:21  Aggiornato: 14/8/2007 3:21
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Redazione: carini quelli che dicono "sbaglia questo, non capisce quello, dimentica di considerare quell'altro...", ma poi si dimenticano di raccontarci come sarebbero andate le cose.


Ora posso parlare solo per me, non ho intenzione di formulare nessuna teoria alternativa, ti ho già detto che per me può anche essere che un'entità aliena abbia seminato la Terra per farci nascere.

L'unica cosa che ho "attaccato" è stato il modo di tirar fuori calcoli probabilistici. Il "metodo turco", di sicuro, è sbagliato.



Purtroppo l'esempio del rottamaio non funge.

Perché i rottami sono passivi ed inerti. La materia biologica è attiva ed adattativa.

Basta un seme, basta l'ABC per poi scrivere la divina commedia. Ma se si parte dalla divina commedia ci si perde, e si dice "non è possibile".

Una lettera per volta, da lì si deve partire.

Perciò dico che, in fondo, quello che dice Massimo e quello che dice Nottrz sono compatibili, l'armonia base, Dio, è quello.

Ma sempre e solo se si parte dal singolo elemento costitutivo.

Le scimmie dattilografe, non devono scrivere la divina commedia, ma "io" "tu" "ape" "mela" al massimo, da qui si parte.

Il resto, appunto, evolve su tali basi.

nessuno
Inviato: 14/8/2007 7:47  Aggiornato: 14/8/2007 7:47
Mi sento vacillare
Iscritto: 30/7/2005
Da: Albino (BG) - Bassa Valle Seriana
Inviati: 501
 Re: Gli anelli mancanti continuano ad aumentare
Redazione scrive:
Citazione:
Non sarà "scientifico", ma a me basta e avanza.


Può essere che ti basti, ma mi pare strano. A me non basta l'Amministrazione USA a farmi credere alla VU, e a te nemmeno. Permetti che mi sembri, il tuo, un argomento molto "debole"?

Oldboy:
Citazione:
L'esempio del Boeing che si forma per caso, citato da Mazzucco, mi ha ricordato una considerazione del matematico e astronomo Fred Hoyle.


So let's play the creationist game and look at forming a peptide by random addition of amino acids. This certainly is not the way peptides formed on the early Earth, but it will be instructive.

I will use as an example the "self-replicating" peptide from the Ghadiri group mentioned above [7]. I could use other examples, such as the hexanucleotide self-replicator [10], the SunY self-replicator [24] or the RNA polymerase described by the Eckland group [12], but for historical continuity with creationist claims a small peptide is ideal. This peptide is 32 amino acids long with a sequence of RMKQLEEKVYELLSKVACLEYEVARLKKVGE and is an enzyme, a peptide ligase that makes a copy of itself from two 16 amino acid long subunits. It is also of a size and composition that is ideally suited to be formed by abiotic peptide synthesis. The fact that it is a self replicator is an added irony.

The probability of generating this in successive random trials is (1/20)32 or 1 chance in 4.29 x 1040. This is much, much more probable than the 1 in 2.04 x 10390 of the standard creationist "generating carboxypeptidase by chance" scenario, but still seems absurdly low.

However, there is another side to these probability estimates, and it hinges on the fact that most of us don't have a feeling for statistics. When someone tells us that some event has a one in a million chance of occuring, many of us expect that one million trials must be undergone before the said event turns up, but this is wrong.

Here is a experiment you can do yourself: take a coin, flip it four times, write down the results, and then do it again. How many times would you think you had to repeat this procedure (trial) before you get 4 heads in a row?

Now the probability of 4 heads in a row is is (1/2)4 or 1 chance in 16: do we have to do 16 trials to get 4 heads (HHHH)? No, in successive experiments I got 11, 10, 6, 16, 1, 5, and 3 trials before HHHH turned up. The figure 1 in 16 (or 1 in a million or 1 in 1040) gives the likelihood of an event in a given trial, but doesn't say where it will occur in a series. You can flip HHHH on your very first trial (I did). Even at 1 chance in 4.29 x 1040, a self-replicator could have turned up surprisingly early. But there is more.

1 chance in 4.29 x 1040 is still orgulously, gobsmackingly unlikely; it's hard to cope with this number. Even with the argument above (you could get it on your very first trial) most people would say "surely it would still take more time than the Earth existed to make this replicator by random methods". Not really; in the above examples we were examining sequential trials, as if there was only one protein/DNA/proto-replicator being assembled per trial. In fact there would be billions of simultaneous trials as the billions of building block molecules interacted in the oceans, or on the thousands of kilometers of shorelines that could provide catalytic surfaces or templates [2,15].

Let's go back to our example with the coins. Say it takes a minute to toss the coins 4 times; to generate HHHH would take on average 8 minutes. Now get 16 friends, each with a coin, to all flip the coin simultaneously 4 times; the average time to generate HHHH is now 1 minute. Now try to flip 6 heads in a row; this has a probability of (1/2)6 or 1 in 64. This would take half an hour on average, but go out and recruit 64 people, and you can flip it in a minute. If you want to flip a sequence with a chance of 1 in a billion, just recruit the population of China to flip coins for you, you will have that sequence in no time flat.

So, if on our prebiotic earth we have a billion peptides growing simultaneously, that reduces the time taken to generate our replicator significantly.

Okay, you are looking at that number again, 1 chance in 4.29 x 1040, that's a big number, and although a billion starting molecules is a lot of molecules, could we ever get enough molecules to randomly assemble our first replicator in under half a billion years?

Yes, one kilogram of the amino acid arginine has 2.85 x 1024 molecules in it (that's well over a billion billion); a tonne of arginine has 2.85 x 1027 molecules. If you took a semi-trailer load of each amino acid and dumped it into a medium size lake, you would have enough molecules to generate our particular replicator in a few tens of years, given that you can make 55 amino acid long proteins in 1 to 2 weeks [14,16].

So how does this shape up with the prebiotic Earth? On the early Earth it is likely that the ocean had a volume of 1 x 1024 litres. Given an amino acid concentration of 1 x 10-6 M (a moderately dilute soup, see Chyba and Sagan 1992 [23]), then there are roughly 1 x 1050 potential starting chains, so that a fair number of efficent peptide ligases (about 1 x 1031) could be produced in a under a year, let alone a million years. The synthesis of primitive self-replicators could happen relatively rapidly, even given a probability of 1 chance in 4.29 x 1040 (and remember, our replicator could be synthesized on the very first trial).

Assume that it takes a week to generate a sequence [14,16]. Then the Ghadiri ligase could be generated in one week, and any cytochrome C sequence could be generated in a bit over a million years (along with about half of all possible 101 peptide sequences, a large proportion of which will be functional proteins of some sort).

Although I have used the Ghadiri ligase as an example, as I mentioned above the same calculations can be performed for the SunY self replicator, or the Ekland RNA polymerase. I leave this as an exercise for the reader, but the general conclusion (you can make scads of the things in a short time) is the same for these oligonucleotides.



Perdonate l'inglese, ma alle 7 e mezza (e prima di dipingere casa) il meglio che posso fare è riportare l'argomentazione originale.

A mio parere si confondono troppe cose: la teoria dell'evoluzione c'entra con l'origine della vita come i cavoli con il cioccolato. La prima riguarda i meccanismi che hanno portato dal primo organismo vivente alal situazione attuale. La seconda questione è del tutto differente e non c'entra nulla con la prima. Continuare a mescolarle non rende un buon servizio a nessuno, a mio parere.

Buona vita

Guglielmo

"Quieremos organizar lo entusiasmo, no la obediencia" - Buenaventura Durruti
Redazione
Inviato: 14/8/2007 9:59  Aggiornato: 14/8/2007 10:05
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
REFRATTARIO: 700 milioni di anni sono l'età dello stagno primordiale, non li ho decisi io. Prima la terra era troppo calda per permettere una qualunque condizione di vita.

°°°

MORFEO: Citazione:
"Basta un seme, ..."
Certo che basta: nel seme c'è già tutto. E' dalla poltiglia caotica al seme che la vedo dura.

Citazione:
Purtroppo l'esempio del rottamaio non funge. Perché i rottami sono passivi ed inerti. La materia biologica è attiva ed adattativa.
Certo, ma prima di diventare organica, bisogna che qualcuno l'abbia "organizzata", no?

L'esempio del rottamaio funge proprio perchè il vento che muove i rottami è l'esatto equivalente del "mestolo" primordiale.

Citazione:
Le scimmie dattilografe, non devono scrivere la divina commedia, ma "io" "tu" "ape" "mela" al massimo, da qui si parte.
La prossima volta che faccio un articolo ci provo: io scrivo il titolo, e poi aspetto di veder uscire il resto .

°°°

Vedo che nessuno si stupisce di quello che continuo a sottolineare: come mai non esiste, in nessun luogo al mondo, una teoria dello sviluppo della vita, dallo stagno a Leonardo, completa e dettagliata?

Timor
Inviato: 14/8/2007 10:46  Aggiornato: 14/8/2007 10:46
Mi sento vacillare
Iscritto: 14/11/2005
Da:
Inviati: 639
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Vedo che nessuno si stupisce di quello che continuo a sottolineare: come mai non esiste, in nessun luogo al mondo, una teoria dello sviluppo della vita, dallo stagno a Leonardo, completa e dettagliata?


Vuoi capire il codice con un altro codice ?

Da http://en.wikipedia.org/wiki/Map-territory_relation

Korzybski's dictum ("The map is not the territory") is also cited as an underlying principle used in neuro-linguistic programming, where it is used to signify that individual people in fact do not in general have access to absolute knowledge of reality, but in fact only have access to a set of beliefs they have built up over time, about reality. So it is considered important to be aware that people's beliefs about reality and their awareness of things (the "map") are not reality itself or everything they could be aware of ("the territory").

"Il vero Big Bang è la nascita di una coscienza"

"Visita Interiora Terrae Rectificando Invenies Occultum Lapidem"
Redazione
Inviato: 14/8/2007 10:56  Aggiornato: 14/8/2007 10:57
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
TIMOR: "Vuoi capire il codice con un altro codice ?"

No, voglio sapere come hanno fatto delle molecole inerti a diventare da sole Leonardo da Vinci (o anche solo Berlusconi, volendo).

Tutti mi dicono che è la cosa più normale del mondo, ma nessuino sa raccontarmi come è successo.

Timor
Inviato: 14/8/2007 11:08  Aggiornato: 14/8/2007 11:08
Mi sento vacillare
Iscritto: 14/11/2005
Da:
Inviati: 639
 Re: Gli anelli mancanti continuano ad aumentare
E pensi che qualcuno a parte te abbia la risposta ?

"Il vero Big Bang è la nascita di una coscienza"

"Visita Interiora Terrae Rectificando Invenies Occultum Lapidem"
astro
Inviato: 14/8/2007 11:10  Aggiornato: 14/8/2007 11:10
Ho qualche dubbio
Iscritto: 3/6/2006
Da:
Inviati: 233
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Vedo che nessuno si stupisce di quello che continuo a sottolineare: come mai non esiste, in nessun luogo al mondo, una teoria dello sviluppo della vita, dallo stagno a Leonardo, completa e dettagliata?


Per lo stesso motivo per cui non esiste una teoria sulla natura dei fulmini globulari?

Citazione:
"EVOLUZIONISTI": Allora facciamo così, lo dico in modo "non scientifico" del tutto: avendo a disposizione settecento milioni di anni, e da una parte un rottamaio "enorme", dall'altra uno stagno primordiale, si assembla da solo prima un Boeing o Leonardo da Vinci?


La prima zero, la seconda tendente a zero.

Citazione:
Quello che voglio dire è che finchè si guarda alla singola proteina si può anche sostenere che ce la può fare. Ma quando consideri quello scalino il primo di una lunghissima serie, NECESSARIAMENTE ININTERROTTA E SEMPRE PIU COMPLESSA, a me semplicemente viene da ridere.


Ecco, il problema è tutto qui.

Quando hai della "materia" (organica non significa vivente, btw, come Friedrich Woehler ha recentemente dimostrato, all'incirca nel 1828 milleottocentoventotto) che nasce, cresce, si riproduce e muore (o in altri termini, che contrasta l'entropia) arrivare a Leonardo da Vinci* non è poi così difficile.

Si continua a portare l'esempio delle scimmie e della Divina Commedia.
Se parti da delle scimmie che "battono a caso" hai una certa probabilità.
Se parti da scimmie che sanno scrivere, inteso che scrivono solamente frasi di senso compiuto, hai un'altra probabilità.
Se il risultato atteso poi non è la divina commedia, una qualsiasi "storiella", hai altre probabilità ancora.

Il problema è insegnare a scrivere alla scimmie...


*Continui a fissare il risultato a posteriori. Che probabilità avevi stamattina, tra tutti gli abiti che possiedi, di vestire proprio nell'esatto modo in cui sei vestito ora? Di scegliere tra 100 mutande proprio quelle, tra 100 calzini proprio quelli, tra 100 pantaloni proprio quelli, tra 100 canottiere proprio quella, tra cento camicie proprio quella, etc etc. 1 su 10000000000? Ergo, Mazzucco, tu ora sei nudo.


----

@Nessuno: e stiamo a 151

Timor
Inviato: 14/8/2007 11:18  Aggiornato: 14/8/2007 11:18
Mi sento vacillare
Iscritto: 14/11/2005
Da:
Inviati: 639
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Ecco, il problema è tutto qui.


Grazie astro adesso so da dove vengo e dove sto andando che poi era la domanda di Massimo

Ti avessi incontrato prima

"Il vero Big Bang è la nascita di una coscienza"

"Visita Interiora Terrae Rectificando Invenies Occultum Lapidem"
astro
Inviato: 14/8/2007 11:30  Aggiornato: 14/8/2007 11:30
Ho qualche dubbio
Iscritto: 3/6/2006
Da:
Inviati: 233
 Re: Gli anelli mancanti continuano ad aumentare
Timor fa piacere che tu abbia risolto i tuoi dubbi esistenziali dalle poche righe che ho scritto con tutt'altra intenzione.

Se vuoi rendere edotto anche me te ne sarei grato.

Timor
Inviato: 14/8/2007 11:55  Aggiornato: 14/8/2007 11:55
Mi sento vacillare
Iscritto: 14/11/2005
Da:
Inviati: 639
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Timor fa piacere che tu abbia risolto i tuoi dubbi esistenziali dalle poche righe che ho scritto con tutt'altra intenzione.


Allora non hai capito la domanda di Massimo.

Massimo cerca una spiegazione del perchè avvengano i fatti, chiamala pure storia o evoluzione non capendo che siamo come ciechi nelle tenebre e che la nostra mente logica non è struttura per rispondere a questa domanda (o forse lo sa e si diverte a prenderci per il culo ).

Anzi presuppone un codice, che verosimilmente esiste ma non è comprensibile logicamente (paradosso), e un creatore del codice che potrebbe essere anche e solo lui stesso (idealismo) pur non sapendolo.

Non riesce a trovare un senso nella successione degli eventi casuali a cui gli scientisti, creatori di miti, danno i nomi più assurdi quali evoluzionismo, adattabilità, principi di conservazione, procreazione etc pensando che dando un nome alle cose (novelli adami) potranno padroneggiarle sentendosi al sicuro e potenti.
Ma quel senso non esiste, Dio non ha mente

"Il vero Big Bang è la nascita di una coscienza"

"Visita Interiora Terrae Rectificando Invenies Occultum Lapidem"
Anonimo
Inviato: 14/8/2007 12:00  Aggiornato: 14/8/2007 12:00
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Certo che basta: nel seme c'è già tutto. E' dalla poltiglia caotica al seme che la vedo dura.


Non è dura, se hai letto quel bellissimo articolo in inglese di Ian Musgrave che in molti stiamo linkando e ri-linkando e quotando, vedi che le probabilità che si formi un probionte non sono poi così dure.

Citazione:
Certo, ma prima di diventare organica, bisogna che qualcuno l'abbia "organizzata", no?


No, perché si organizza da sola sottostando alle leggi della biochimica.

Citazione:
L'esempio del rottamaio funge proprio perchè il vento che muove i rottami è l'esatto equivalente del "mestolo" primordiale.


No, perché per quento primordiali e non vive, comunque interagisco, sempre secondo quelle leggi.

Citazione:
Vedo che nessuno si stupisce di quello che continuo a sottolineare: come mai non esiste, in nessun luogo al mondo, una teoria dello sviluppo della vita, dallo stagno a Leonardo, completa e dettagliata?


Ma perché dovrebbe esserci? Ci sono una marea di cose esistenti che ancora non sono state spiegate. Solo perché non sono state spiegate non esistono?

Ed è questa tua domanda che vuole distogliere l'attenzione.

Noi stiamo solo dicendo che il turco sbaglia a porre la questione probabilistica in quel modo, per basare su quello l'attacco all'evoluzione.

Da qui a chiedere di sviluppare un'intera teoria, con tutti i passaggi dal abiotico a Leonardo, altrimenti non possiamo dire male del turco, mi sembra alquanto esagrata come pretesa.

P.S.
Come sia uscito fuori Leonardo mi pare ovvio, il padre si trombò la madre. Ma se ci mettiamo a calcolare, con il metodo turco, quante probabilità ci fossere perché proprio quel seme potesse incontrare quell'uvulo...

Mi sa che Leonardo probabilisticamente tendeva a zero.

Eppure...

nottrz
Inviato: 14/8/2007 12:19  Aggiornato: 14/8/2007 12:43
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Fabrizio70
Citazione:

sarebbe interessante sapere allora quali sono le leggi che regolano la riproduzione del dna , lo "scopo" della vita , sono millenni che se ne parla...


Le uniche ricerche in questo senso che conosco sono quelle sulla complessita', in particolare in ambito biologico quelle di Kauffman.
Qui potete trovare un articolo che riassume alcune delle idee principali.
La comparsa della vita viene visto come una "transizione di fase" (come quella a acqua a ghiaccio) che si verifica spontaneamente quando la complessita' delle interazioni tra gli elementi di un sistema supera una certa soglia.
Un libro introduttivo e' il gia' citato A casa nell'universo.
Gia che ci sono suggerisco anche Il paradigma perduto di Edgar Morin, un libro di antropologia che affronta la formazione delle prime societa' umane con lo stesso approccio.
Cito sempre Kauffman, ma alla fine dell'articolo segnalato da nessuno potete trovare un sacco di altri riferimenti.

Massimo
Citazione:

Lo ripeto - e questa ricerca l'ho fatta a fondo - NON ESISTE una spiegazione completa ed esaustiva che ci racconti dettagliatamente i mille passaggi dalla prima ameba a Leonardo. Si dice semplicemente che è possibile poichè non è dimostrabile che sia impossibile.


I passaggi dall'ameba a Leonardo non sono mille, sono un numero immenso. Censirli tutti richiederebbe milioni di anni oltre all'impossibilita' pratica visto che molti passaggi possono essere stati fatti, disfatti, ricombinati, ecc.
La macro descrizione migliore che abbiamo e' quella data dallo studio dei fossili e la loro datazione combinata con l'analisi del patimonio genetico delle specie viventi. Quella che ci dice che i pesci sono diventati rettili, e ce lo dice in un modo ben piu' dettagliato di questo, indicando magari anche numerose specie intermedie. Si suppone che questa nel tempo andra' raffinandosi.
Quindi questa descrizione/spiegazione ESISTE, la trovi su tutti, quasi, i libri di scuola.
Poi ognuno e' libero, dopo averla studiata nel dettaglio o meno, di scartarla come poco convincente e cercare un modello migliore (verificabile, falsificabile, coerente, ecc.) per tenere assieme quegli stessi elementi.
Che io sappia non esiste nessun modello in nessun ramo di ricerca che sia "completo ed esaustivo", sono tutti di fatto delle bozze.

Pero', detta terra terra, mi sembra come uno che rifiuti l'ipotesi di una demolizione controllata a meno che non gli venga indicata la posizione esatta in cui sarebbe stata piazzata ogni singola carica.

Non cercavamo forse la "big picture"?

Esistono delle teorie che spiegano, e sperimentano, come dei salti di complessita' possano avvenire in modo spontaneo, sia su scala microscopica che macroscopica. Non ci sono motivi particolari per pensare che questi stessi fenomeni non avvengano anche nella formazione delle forme di vita e nei loro passaggi da unicellulare e pluricellulare (sempre tenendo conto che non stiamo parlando degli organismi moderni...).
Abbiamo poi motivi di ritenere che il passaggio da, vado a spanne, unicellulare a pluricellulare sia piu' difficile di quello avvenuto da brachiopodi(?) a proto-pesci(agnati)? Secondo me no, ma qui non penso ci siano molti indizi in merito.

Non so se siamo d'accordo sul fatto che tutti i calcoli probabilistici fatti in proposito siano senza senso. In questo caso quale restano gli enormi difetti dell'evoluzionismo? La scarsita' di fossili delle forme intermedie?
Il fatto che il laboratorio non siamo riusciti a riprodurre processi che hanno richiesto centinaia di milioni di anni ma solamente quelli che richiedono tempi piu' brevi?
Oppure la mancanza di "leggi scientifiche" che avrebbero spinto questo processo? Queste "leggi" ci sono, negarlo significa ignorare gli ultimi 50 anni di ricerche su chaos, complessita', strutture dissipative, teoria dei sistemi, simulazioni artificiali, ecc.


Un paio di link:

Percorso evolutivo:
http://www.bo.astro.it/universo/webuniverso/bonfitto/bonfitto1b.html

Organizzazione/specializzazione delle amebe
http://darwininitalia.blogspot.com/2006/11/levoluzione-degli-organismi.html


Citazione:

Certo, ma prima di diventare organica, bisogna che qualcuno l'abbia "organizzata", no?

L'esempio del rottamaio funge proprio perchè il vento che muove i rottami è l'esatto equivalente del "mestolo" primordiale.


Come gia' detto da Morfeo le caratteristiche del metallo non sono il massimo per creare vita. Primo perche' non si legano facilmente tra loro creando macro strutture. Questo le lascia sempre uguali a loro stesse, cozzano e rimbalzano. Secondo problema: un tornado e' un po' troppo violento per permettere che si creino dei "gruppetti", cosi' come l'assenza di vento non andrebbe bene. Poi c'e' poca varieta': i pezzi sono quesi tutti di metallo e le combinazioni di metallo con metallo non sono molte. Infine i rottami sono pochi, servirebbe qualche milione di Boeing per cominciare a fare qualcosa (ovviamente dopo aver risolto tutti gli altri problemi, in particolare il primo).

[AGGUINTO]
Manca poi del tutto la selezione naturale che opera in modo non casuale per portarci al nostro obiettivo selezionando le forme intermedie piu' promettenti. Infine qui l'obiettivo e' preposto, in natura no (l'unico "salvagente" e' la capacita' dell'organismo di replicarsi efficacemente).


Al2012

Citazione:

Questo ragionamento porta ha considerare la coscienza come un effetto della complessità biologica, però c’è un problema, (per quanto so) non si sa dove mettere la coscienza, in quale organo biologico possiamo mettere di casa la coscienza ??


Come mai dovremmo collocarla in un organo biologico?
In quale organo e' collocato il movimento? Potremmo dire nei muscoli e nel sistema nervoso, ma anche nella struttura ossea, tendini e organi dell'equilibrio e nel cervello che coordina il tutto. Questi probabilmente sono quelli che giocano il ruolo maggiore.
La coscienza emerge dalla collaborazione di diversi organi, da quelli di senso al cervello, dlla possibilita' di esplorare il territorio e interagire con altri esseri.
A che pro collocarla in un punto specifico? Penso che nelle prime ricerche biologiche ci fosse queste tendenza a chiedersi "a chi serve questo coso?" e ad assegnarli quindi una funzione ben definita e localizzata. Penso che in tempi recenti si sia scoperto che questa visione e' quasi sempre semplicistica.

Anonimo
Inviato: 14/8/2007 12:28  Aggiornato: 14/8/2007 12:28
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Penso che nelle prime ricerche biologiche ci fosse queste tendenza a chiedersi "a chi serve questo coso?" e ad assegnarli quindi una funzione ben definita e localizzata. Penso che in tempi recenti si sia scoperto che questa visione e' quasi sempre semplicistica.


Un po' come l'otturazione dentale sbagliata porta al mal di ginocchia per errata postura.

Possibile mai immaginare, sezionando cadaveri, che dente e ginocchio possano essere collegati

Eppure...

Timor
Inviato: 14/8/2007 12:32  Aggiornato: 14/8/2007 12:32
Mi sento vacillare
Iscritto: 14/11/2005
Da:
Inviati: 639
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Queste "leggi" ci sono


Come disse il buon Tacchino

A parte la frecciatina concordo con Citazione:
Poi ognuno e' libero, dopo averla studiata nel dettaglio o meno, di scartarla come poco convincente e cercare un modello migliore (verificabile, falsificabile, coerente, ecc.) per tenere assieme quegli stessi elementi.


Ecco cerchiamo di tenerli insieme per carità!!

Un regalo: http://en.wikipedia.org/wiki/General_semantics

"Il vero Big Bang è la nascita di una coscienza"

"Visita Interiora Terrae Rectificando Invenies Occultum Lapidem"
olah
Inviato: 14/8/2007 12:51  Aggiornato: 14/8/2007 12:51
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Oldboy, io ti ho citato uno dei tanti articoli di Shapiro ( A 21st Century View of evolution ) nel quale si descrive quanto il DNA sia dinamico e mutabile, perché tu lo hai citato per dire che il DNA è immutabile, cioè per sostenere esattamente il contrario di quanto sostiene la tua fonte.

Per quanto riguarda i proofreading mechanisms, Shapiro non ha detto che funzionano come il correttore di Word e, tanto meno, che questi rendano il DNA immutabile.

Se vuoi provo a spiegarti brevemente (semplificando, naturalmente...) il principio su cui si basa il sistema di correzione: un gruppo di proteine rivela una distorsione nella catena del DNA, taglia via alcuni nucleotidi e li re-inserisce usando una delle due catene come stampo. In questo processo il sistema di correzione può re-inserire i nucleotidi giusti oppure dei nucleotidi sbagliati, generando una mutazione, soprattutto se una base è depurinata è lui non sa quale dei due stampi è quello giusto.

In ogni caso, se non sei un troll non puoi non ammettere che Shapiro sostiene che il DNA sia decisamente mutabile, soggetto a continui cambiamenti responsabili del processo evolutivo. Quindi non è lui che sostiene, e ti cito:

Citazione:
E' un meccanismo di "correzione tipografica" simile a quello dei sistemi di scrittura computerizzata.

Questo rende ancora più improbabili le fantasticherie dell'evoluzionismo, perché il DNA si difende da quelle "mutazioni casuali" che sarebbero alla base dell'evoluzione.
Il DNA è stabile, molto più di quello che si pensava: è forse la struttura più stabile dell'universo.


Questa è una tua idea che non puoi usare come corrolario del pensiero di una persona che la pensa in maniera opposta alla tua, o quanto meno non senza dire che la tua fonte si sbaglia e ha preso una cantonata, correggendolo e dicendo dove ha sbagliato (se ti senti in grado di contraddire un decano come Shapiro nella sua area di competenza...).

slump
Inviato: 14/8/2007 12:55  Aggiornato: 14/8/2007 12:55
Ho qualche dubbio
Iscritto: 8/6/2006
Da:
Inviati: 199
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
SLUMP: Per quel che riguarda i moventi / i responsabili, aspetta “La Verità di Cristallo”.


Che è? Un libro?

Citazione:
-citazione-

Citazione:
quello che volevo dire è che il ragionamento probabilistico a posteriori che facciamo non ha senso, come ha già detto qualche altro dei commentatori, non ha senso proprio perché parte da un punto di vista posteriore e finalistico


Perchè non dovrebbe avere senso, scusa? Quando diciamo che non è possibile che quattro persone che non hanno mai guidato un jet nella loro vita abbiano fatto le acrobazie viste fare agli aerei del 9/11, non facciamo un ragionamento probabilistico a posteriori? Perchè questo è accettabile, e l’altro no?


Non ha senso perché comunque una tra le X possibilità doveva uscire. È innanzitutto un problema psicologico per noi: ci pare che qualcosa o Qualcuno abbia congiurato o agito per farci nascere proprio perché le probabilità che noi ci fossimo ci appaiono, su scala umana, infinitesime. Ma, ripeto, non abbiamo assolutamente idea del numero di "tentativi" fatti nel tempo e nello spazio.

Sui piloti del 9/11: qui sappiamo con ragionevole certezza che quei piloti -- o quel pilota se parliamo solo di Hanjour del Pentagono, hanno avuto un solo tentativo a disposizione. Se sapessimo che su 10^1000 pianeti 10^1000 Hanjour avessero provato non troveremmo strano che almeno uno di loro sia riuscito. Magari invece troveremmo strano che sia ruscito a farlo proprio sul nostro pianeta: probabilmente ci sembrerebbe che dietro ci sia un qualche disegno divino. È la nostra mente che ragiona con categorie finalistiche, probabilmente innate, non lo so.

Ma a proposito di 9/11 e probabilità mi permetto un breve excursus OT: tempo fa avevo rozzamente calcolato le probabilità che certi numeri che coinvolgono il 911 e altri attentati famosi seguenti (quello di Madrid e Londra) fossero "casuali". Naturalmente le probabilità erano ultra basse! Se ritrovo lo scritto lo posto da qualche parte.

Quali erano i numeri? In particolare la data e i numeri degli aerei. Non so se qualcuno l'aveva notato finora ma si tratta sempre di numeri DISPARI: 11, 9, 2001, 11, 77, 93, 175 --- ma si potrebbe aggiungere anche i 19 dirottatori, i 3 bersagli colpiti, 5 lati del Pentagono... .

Se poi aggiungiamo 11/3 a Madrid e 7/7 a Londra...

E non sono numeri scelti tra alcuni equivalenti per importanza, sono quelli che compaiono sempre in qualunque resoconto dell'accaduto!

"In powerful rain, they laid down their heads to die"
(My Dying Bride)
Redazione
Inviato: 14/8/2007 13:02  Aggiornato: 14/8/2007 13:04
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
MORFEO:Citazione:
No, perché si organizza da sola sottostando alle leggi della biochimica.
Non sapevo che nel caos esistessero leggi.

Citazione:
Ma perché dovrebbe esserci [la teoria completa]?
Perchè c’è chi sostiene che veniamo da lì. Ma ora che avete riconosciuto che la teoria non esiste, mi state dicendo che lo fa senza nessuna fondatezza. Come volevasi dimostrare.

Per quel che mi riguarda, la discusssione è abbondantemente chiusa (stiamo girando in tondo da almeno tre turni di post). Vi ringrazio per aver partecipato.

Massimo

slump
Inviato: 14/8/2007 13:29  Aggiornato: 14/8/2007 13:29
Ho qualche dubbio
Iscritto: 8/6/2006
Da:
Inviati: 199
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
No, voglio sapere come hanno fatto delle molecole inerti a diventare da sole Leonardo da Vinci (o anche solo Berlusconi, volendo).


Nel secondo caso bisognerebbe dar ragione a Sermonti (Giuseppe): è vera e propria deevoluzione (ma anche guardandosi solo in giro vien spesso voglia di dar ragione a lui... )



Tornando in topic: sull'evoluzione dalle prime molecole organiche a Leonardo ho anch'io molti dubbi. Il caso e la necessità di cui parlava Monod mi paiono insufficienti, soprattutto per una questione temporale. O c'è dell'altro che accade a livello genetico (e alcune ricerche di cui s'è parlato anche qui sembrano confermarlo) oppure non so. Tenderei però ad escludere Dio, più che altro per carità nei suoi confronti (visto il Berlusca e tanti altri), perlomeno il Dio d'amore dei cristiani: andrebbe meglio il Dio che se ne frega di alcune sette gnostiche o il bimbo alieno di cui saremmo il giocattolo...

Oppure potremmo essere una simulazione al computer. Nick Bostrom, un serio docente ad Oxford, ritiene quest'ultima possibilità non certo remota, anzi, le da un 20% di possibilità anche se lui non la ritiene reale. Vedere questo suo sito sull'argomento: http://www.simulation-argument.com/
che contiene l'intero saggio su questo argomento pubblicato su una rivista filosofica un 3 o 4 anni fa e che lo ha reso discretamente famoso.

Ma tutta la sua home page è molto interessante: http://www.nickbostrom.com/

"In powerful rain, they laid down their heads to die"
(My Dying Bride)
Anonimo
Inviato: 14/8/2007 13:34  Aggiornato: 14/8/2007 13:36
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Non sapevo che nel caos esistessero leggi.


Mi sa che c'è un po' di confusione allora.

Un sistema caotico risponde comunque a delle leggi, ma sono un bel po' complesse per i nostri limitati cervelli.

Ma perché cellule organiche (che non significa vive) non dovrebbero rispettare le leggi della chimica?

Citazione:
Perchè c’è chi sostiene che veniamo da lì. Ma ora che avete riconosciuto che la teoria non esiste, mi state dicendo che lo fa senza nessuna fondatezza. Come volevasi dimostrare.


Varamente, e ripeto per l'ennesima volta, io sto solo dicendo che i calcoli probabilistici del turco si fondano su inesattezze.

Poi sei libero di metterci tutti i corollari che vuoi, ma sarebbe gradito rimanre strettamente in argomento.

Nottrz ti ha risposto piuttosto approfonditamente riguardo l'esistenza della teoria...

Citazione:
Per quel che mi riguarda, la discusssione è abbondantemente chiusa (stiamo girando in tondo da almeno tre turni di post). Vi ringrazio per aver partecipato.


O_O

Se girare in tondo significa non ammettere che il turco ha torto e chiedere però un'intera teoria, beh allora hai ragione.

nottrz
Inviato: 14/8/2007 14:08  Aggiornato: 14/8/2007 15:06
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Non sapevo che nel caos esistessero leggi.


Invece ce ne sono, basta una semplice ricerca su google.

C'e' addirittura un libro di Prigogine che si intitola Le leggi del caos.

Come libro posso consigliarti Chaos di Gleick.

Ovviamente parlo del caos in ambito matematico/fisico, se il termine viene usato in senso lato allora, bhe, puo' significare un po' quello che si vuole.

Citazione:
Perchè c’è chi sostiene che veniamo da lì. Ma ora che avete riconosciuto che la teoria non esiste, mi state dicendo che lo fa senza nessuna fondatezza. Come volevasi dimostrare.


Chi e' che ha riconosciuto cosa??
Il quoting dal post di Morfeo mi sembra a dir poco chirurgico...

No, non c'e' una teoria che abbia ancora ricostruito/documentato tutti i numerosissimi micro passaggi da ameba a Leonardo.
Peccato pero' che con questo approccio bisognerebbe scartare _tutte_ le teorie scientifiche note. Nessuna teoria spiega nel dettaglio come funzioni il sole, come funzioni il sistema solare o un atomo di elio.
Chissa' come mai pero' quando tornano comode per fare i calcoli sul crollo delle torri gemelle queste teorie diventano improvvisamente dei baluardi...

Polemico: certo poi che se ignori tutto il materiale e le argomentazioni che ti vengono proposte di certo non riuscirai mai a trovare la teoria che dici di aver ricercato "a fondo".

Citazione:
Per quel che mi riguarda, la discusssione è abbondantemente chiusa (stiamo girando in tondo da almeno tre turni di post). Vi ringrazio per aver partecipato.


???

[AGGIUNTO]
P.S.
Il post sul calcolo delle probabilita' sugli attentati che ho scritto e' sbagliato, la cosa e' molto piu' semplice.
Nel caso della proteina avevamo n eventi con la stessa improbabilita' di verificarsi e si e' semplicemente realizzato uno tra questi.
Nel caso dell'11 settembre quella mattina potevano succedere un sacco di altre cose statisticamente piu' probabili e invece e' successa proprio una di quelle meno probabili.

olah
Inviato: 14/8/2007 15:10  Aggiornato: 14/8/2007 15:10
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Perchè c’è chi sostiene che veniamo da lì. Ma ora che avete riconosciuto che la teoria non esiste, mi state dicendo che lo fa senza nessuna fondatezza. Come volevasi dimostrare.


Non è vero che non c'è fondatezza, il problema è che cerchi una spiegazione meccanicistica o probabilistica per un sistema caotico. Non lo puoi fare, perché il numero di variabili è troppo grande.

Lasciamo i dadi a casa, caos e caso non sono sinonimi, anche se uno è l'anagramma dell'altro.

Prova invece, come ipotesi di lavoro, a considerare validi due presupposti:

1) Sistemi semplici possono dare origine a sistemi complessi in modo deterministico
2) Tali sistemi possono creare sotto-insiemi che sinergizzano facendo crescere la complessità in modo esponenziale

I presupposti sono validi? E' una cosa che possiamo sperimentare, io ho fatto l'esempio dei frattali. Quindi la mia risposta è sì, se lo è anche per te allora puoi provare a usare un nuovo metodo d'indagine.

Se i presupposti sono validi, è possibile che un brodo di materiale organico e acqua dia origine, in modo deterministico, ad organismi viventi e che questi organismi diano origine ad altri organismi sempre più complessi? Se la risposta è sì, allora resta da capire quali potessero essere le condizioni iniziali e come si potessero evolvere.

Le ipotesi e le basi teoriche non mancano, ad esempio l'ipotesi di Eigen degli ipercicli che generano proto-specie poi soggette all'evoluzione darwiniana, l'ipotesi di Wächtershäuser delle micro caverne vulcaniche, la teoria della bolla e varie altre. Ciò che manca è la possibilità di verificarle con esperimenti di laboratorio, ma qui ci potranno venire in aiuto le equazioni della teoria del caos. Quando avremo una potenza di calcolo sufficiente, potremo azzardare alcune verifiche sperimentali.

slump
Inviato: 14/8/2007 15:23  Aggiornato: 14/8/2007 15:23
Ho qualche dubbio
Iscritto: 8/6/2006
Da:
Inviati: 199
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Ma quel senso non esiste, Dio non ha mente


Dunque è identico al puro caso...

"In powerful rain, they laid down their heads to die"
(My Dying Bride)
Clorofilla
Inviato: 14/8/2007 15:39  Aggiornato: 14/8/2007 15:39
Mi sento vacillare
Iscritto: 6/7/2006
Da:
Inviati: 859
 Re: Gli anelli mancanti continuano ad aumentare
Ci sono delle imprecisioni nell'articolo. Intanto il Sapiensa sapiens non appare 10 mila anni fa, bensì prima in maniera certa e definita. Siamo almeno a 40 mila anni fa. Tant'è che per almeno 5-10 mila anni ha convissuto col Neanderthal in Europa. L'origine è di sicuro più antica. Prima di questa datazione troviamo altri tipi di scheletri, definti come proto-sapiens che hanno caratteristiche scheletriche, sopratutto craniche e dentarie già più vicine al sapiens, pur con elementi ancora di tipo arcaico. Nel medio oriente sono stati ritrovati, in delle sepolture, scheletri di questo tipo, datate fra i 90 mila ed i 60 mila anni fa.

Già da tempo si pensa che che gli australopiteci non siano i diretti antenati, già prima del 2001.

L'uomo di Flores non credo dia colpi all'evoluzione. Esiste l'isolamento e la deriva genetica (collo di bottiglia). In più il fenomeno dell'Insularismo fa si che spesso la fauna nelle isole riduca le dimensioni per spazio e cibo o mancanza di predatori.

Forse la citazione sulla datazione di Herectus voleva dire che potrebbe essere l'Habilis a discendere da questo

Comunque abbiamo anche Homo Rudolfensis ed Ergaster fra i due contendenti!! Come dopo l'Herectus abbiamo anche Homo Antecessor, Georgicus, Heidelbergensis.


Forse chi ha scritto l'articolo, prima di criticare, sarebbe bene studiasse un pochino.

Timor
Inviato: 14/8/2007 15:59  Aggiornato: 14/8/2007 15:59
Mi sento vacillare
Iscritto: 14/11/2005
Da:
Inviati: 639
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Dunque è identico al puro caso


Diciamo che soggettivamente credo in un codice implicato iper-reale e iperlogico, come se vi fossero una o più dimensioni di verità nascoste alla mente umana. Analogia con le geometrie non euclidee.


Ma tanto per il grado di comprensione attuale del mio universo la tua affermazione è cmq contemporaneamente vera e falsa o forse non significa niente

C'è chi preferisce il gelato alla nocciola e chi alla stracciatella

"Il vero Big Bang è la nascita di una coscienza"

"Visita Interiora Terrae Rectificando Invenies Occultum Lapidem"
Oldboy
Inviato: 14/8/2007 16:44  Aggiornato: 14/8/2007 16:44
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Olah,
certo che il DNA è "dinamico": non è materia inerte, ma è in grado di difendersi attivamente da quelle casuali accidentalità e danneggiamenti su cui l'evoluzionismo fonda le sue - mai dimostrate - ipotesi.

Ecco il punto: il DNA è stabilissimo, proprio perché non è una "cosa inerte".
Dice Shapiro:

"Il DNA non è una vittima passiva delle forze casuali della chimica e della fisica."

Di più: si è scoperto che la cellula ha una capicità autonoma di "ingegneria genetica naturale", per cui "taglia, divide e ricongiunge le molecole di DNA per ricostituirle in nuove sequenze".

Quindi il DNA non solo si auto-protegge, ma si auto-riorganizza.
Proprio questo lo rende così stabile, a dispetto delle fantasiose ipotesi evoluzioniste.

Oldboy
Inviato: 14/8/2007 17:14  Aggiornato: 14/8/2007 17:43
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Quanto all'origine della vita, solo una fede dogmatica e incrollabile nell'evoluzionismo può far ritenere che sia dovuta al "caso".

Non è affatto vero che gli evoluzionisti "non si siano mai occupati" di questo problema nodale (come qualcuno ha detto).
Se ne sono occupati, e hanno dovuto prendere atto del totale fallimento di ogni loro spiegazione.

Lo scienziato evoluzionista Harold F.Blum ammette:

"La formazione spontanea di un polipeptide delle dimensioni della più piccola proteina è al di là di ogni probabilità".

Non serve obiettare che la vita ha avuto "moltissimo tempo" per formarsi su questo pianeta.
Infatti non è mai (dicesi mai) stato dimostrato che gli amminoacidi possano formare delle proteine in modo accidentale.

Al proposito, dice il geologo William Stokes:

"Tale probabilità è così remota che non potrebbe realizzarsi nemmeno nel corso di miliardi di anni in miliardi di pianeti, ognuno dei quali ricoperto da una soluzione concentrata di acqua e amminoacidi."

D'altronde, non si è mai riusciti nemmeno a dimostrare che la materia organica possa formarsi a partire da elementi inorganici.
(Cioé a dimostrare che il famoso "primo passo" della vita possa verificarsi in modo accidentale.).

Dice il matematico e astronomo Chandra Wickramasinghe:

"La probablità di una formazione spontanea della vita dalla materia inanimata è pari a 1 seguito da 40.000 zeri.
E' un numero abbastanza grande da seppellire Darwin e l'intera teoria dell'evoluzione.

Non è mai esistito alcun brodo primordiale, né su questo pianeta né su qualsiasi altro, e se l'inizio della vita non fu accidentale, allora deve essere sato prodotto da un'intelligenza con uno scopo ben preciso".

olah
Inviato: 14/8/2007 17:46  Aggiornato: 14/8/2007 17:48
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Di più: si è scoperto che la cellula ha una capicità autonoma di "ingegneria genetica naturale", per cui "taglia, divide e ricongiunge le molecole di DNA per ricostituirle in nuove sequenze".


Appunto, nuove sequenze. Mutazioni. Cambiamento. Evoluzione...

Citazione:
Quindi il DNA non solo si auto-protegge, ma si auto-riorganizza.
Proprio questo lo rende così stabile, a dispetto delle fantasiose ipotesi evoluzioniste.


Chi ha mai detto che il DNA è instabile? Gli evoluzionisti parlano di mutazioni, cioè cambiamenti nella sequenza, in vari modi. Compreso Shapiro, uno di quei "fantasiosi" (a tuo dire) evoluzionisti che tu continui a citare a sproposito.

Oldboy, mi sono convinto che tu sia un troll.

Anonimo
Inviato: 14/8/2007 17:51  Aggiornato: 14/8/2007 18:04
 Re: Gli anelli mancanti continuano ad aumentare
Oldboy:

Citazione:
Lo scienziato evoluzionista Harold F.Blum

è un ignorante, di parte, e 'ste cose le hai prese da "L'inganno dell'evoluzione".

Citazione:
il geologo William Stokes:

è un altro ignorante. Anche questo di parte, visto che queste parole vengono da un sito che si chiama "controevoluzione.it"

Etc...

Questi tuoi commenti, che tirano ancora in ballo chiacchiere sballate sulle probabilità, dimostrano solo che TU stai semplicemente evitando di leggere le cose che ti stiamo dicendo. E che forse non sei in grado ci analizzare autonomamente.

Quindi peschi a caso frasi di "grandi scienziati" che dicono solo un mucchio di stronzate (perdonate il francesismo).

Ma ripeto, ognuno è libero, anche di far brutta figura.
Anche i Troll clericali.

Oldboy
Inviato: 14/8/2007 18:03  Aggiornato: 14/8/2007 18:12
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
No, Olah.
Tu continui a confondere due cose completamente diverse.

Un conto è il naturale, verificabile rimaneggiamento del patrimonio genetico di una specie. (Micromutazione)

Questo fenomeno è comunissimo, fisiologico e - ciò che più conta in ambito scientifico - facilmente verificabile.
I cani possono essere più o meno alti, più o meno robusti, avere questo o quel colore.

Ma - ecco il punto - restano quello che sono sempre stati: cani.

Un altro conto è ipotizzare (senza uno straccio di prova) che un bel giorno alcuni pesci abbiano acquisito caratteri del tutto estranei al patrimonio genetico della loro specie.
(Cioé arti, polmoni, e altri organi completamente inutili, se non dannosi, per un pesce.)

Questa è la - presunta, mai dimostrata - macromutazione, di cui favoleggiano gli evoluzionisti.

Non solo quest'ultimo bizzarro fenomeno non è mai stato dimostrato, ma è contraddetto da tutte le acquisizioni della scienza nell'ultimo secolo e mezzo.
(Per esempio vi si oppone il principio di "complessità irriducibile", formulato come sai da Michael Behe.)

olah
Inviato: 14/8/2007 18:12  Aggiornato: 14/8/2007 18:13
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Oldboy, confermato, sei un troll. Continui a ignorare a piè pari quello che ti ho scritto in precedenza, compreso il punto in cui ti ho già detto che l'dea bislacca delle micro e macro mutazioni è solo nella tua testa.

olah
Inviato: 14/8/2007 18:16  Aggiornato: 14/8/2007 18:16
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Cioé arti, polmoni, e altri organi completamente inutili, se non dannosi, per un pesce


Questa però te la devo dire, spero di non scioccarti: esistono pesci con i polmoni, e anche pesci con pinne muscolari.

Oldboy
Inviato: 14/8/2007 18:22  Aggiornato: 14/8/2007 21:48
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Olah,
è un dato di fatto che la presunta evoluzione da una specie all'altra non è mai stata dimostrata da alcun abitante di questo pianeta.

In ambito scientifico, così come in tribunale, ciò che non è provato non esiste.

Prove che la materia organica si possa formare da elementi inorganici?
Nessuna.

Prove che gli amminoacidi possano formare accidentalmente una proteina?
Nessuna

Prove che esistano, in natura, meccanismi in grado di trasformare i pesci in rettili, i rettili in uccelli e così via?
Nessuna

La risposta è sempre la stessa per decine di altre domande.
(Tutte altrettanto nodali, se non di più.)

(Ed è la stessa risposta che dava lo stesso Darwin: prove non ce ne sono, diceva con una certa onestà. Ma basta cercarle...

Invece è passato un secolo e mezzo, e sono solo i dubbi ad aumentare in modo esponenziale.)

olah
Inviato: 14/8/2007 18:43  Aggiornato: 14/8/2007 18:43
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
In ambito scientifico, così come in tribunale, ciò che non è provato non esiste.


Non mi va di ripetere cose già trite e ritrite... visto che ti manca l'abc, comincia da qui:

http://it.wikipedia.org/wiki/Scienza

da qualche parte bisogna pur partire...

slump
Inviato: 14/8/2007 19:32  Aggiornato: 14/8/2007 20:05
Ho qualche dubbio
Iscritto: 8/6/2006
Da:
Inviati: 199
 Re: Gli anelli mancanti continuano ad aumentare
@ Oldboy

Citazione:
Lo scienziato evoluzionista Harold F.Blum ammette:

"La formazione spontanea di un polipeptide delle dimensioni della più piccola proteina è al di là di ogni probabilità".


Una frase del genere fuori da un contesto non significa nulla, fosse pure di Einstein.

Cosa vuol dire "formazione spontanea"? A partire da cosa e in quanto tempo e con quanti "tentativi"?

Non esiste nulla che stia "al di là d ogni probabilità" dato un tempo abbastanza lungo o un numero di tentativi abbastanza alto. Fare affermazioni senza conoscere né questo né quello è insensato.

Lo stesso vale per la frase seguente di Stokes perché non sappiamo affatto su quanti pianeti e da quanti anni siano in corso questi "tentativi" (anche se la parola "tentativo" non è giusta, si dovrebbe parlare di processi casuali).

L'affermazione di Chandra W. è ancora peggio perché è solo un "ipse dixit" (dove "ipse" è lui).

Se pur fosse vero che la probabilità fosse di 1 seguito da 40mila zeri dove sta dimostrato che su 1 seguito da 400MILA zeri pianeti non si è "provato" a formare la vita?

Quel che dice dopo è anche peggio: se la vita è stata creata da una intelligenza con uno scopo preciso allora CHI/COSA/COME ha creato questa intelligenza?

Ci si aspetterebbe da uno scienziato più onestà intellettuale, ci si aspetterebbe che dicesse che crede in Dio o in un supremo essere alieno e che crede che la vita sia stata materialmente creata da lui/esso. Da questo punto di vista i filosofi/scienziati cristiani del medioevo erano più onesti.

Fino a che non si dimostra che nell'universo è impossibile che la vita si sia formata spontaneamente bisogna stare scientificamente zitti oppure dire semplicemente che si crede, si ha fede in un Creatore (di qualunque genere sia). Credere non impedisce a nessun scienziato di fare il suo lavoro scientifico, l'onestà però imporrebbe di non fare del proprio credo un'ideologia che cerca di spacciare al pubblico pseudoscienza oppure di denigrare la scienza la quale, di suo, ha già molti problemi non solo strettamente scientifici ma anche politici, sociali ecc.

Se io non so come funziona il Sole so però che c'è una teoria scientifica che cerca di spiegare come funziona: la teoria potrebbe essere sbagliata naturalmente. Se mi convinco che è sbagliata cerco di dimostrarlo scientificamente: per farlo devo dimostrare in maniera assoluta che non può essere come dice la teoria ma in maniera assoluta non vuol dire tirare in ballo le probabilità, soprattutto quando non conosco il range delle eventuali possibilità.

Dire oggi "La vita non può essere sorta spontaneamente ma grazie ad una intelligenza" è come dire "Il sole non funziona come dicono ma c'è un'intelligenza che lo fa ardere". Potrebbe essere una posizione rispettabile ma non è scienza come la conosciamo o, meglio, come dovrebbe essere.


Aggiungo che per chi crede in Dio, perlomeno nel Dio creatore delle religioni monoteiste, TUTTO proviene da Dio, non solo la vita ma anche la materia inorganica e l'intero Universo. Non capisco quindi perché si ostinino a negare la nascita spontanea della vita e l'evoluzione: dovrebbero allo stesso modo negare la nascita "spontanea" dell'Universo e di tutto quanto.

Delle due l'una: o Dio ha creato l'universo come un "progetto intelligente" che prevedeva anche la vita (che poi sarebbe arrivata sino all'uomo) oppure ha creato l'universo e la vita tutto in contemporanea oppure a stadi successivi, sempre senza evoluzione (tutte le specie assieme oppure una specie poi l'altra magari facendone sparire qualcuna ecc.). Quale sarebbe lo scandalo teologico dell'evoluzione? Non sarebbe sempre opera di Dio? Anche nella Bibbia sta scritto che Dio ha creato tutto in 6 giorni e poi si è riposato (e l'uomo è giunto alla fine). Non ha fatto tutto d'un colpo. Capire come si è formata la vita, come si è evoluta (o devoluta) mica mette in discussione Dio per un vero credente! D'altra parte Dio mica riesce a mettere in discussione la teoria evolutiva (così come quella del Big Bang o della relatività ecc.).

Se non si capisce che Scienza e Fede possono benissimo coesistere si torna al Medioevo e l'attacco del turco Oktar, ammesso sia lui, all'evoluzione dimostra solo questo: la volontà di impedire alla Ragione di essere autonoma dalla Fede (o, forse, di qualche altro Potere). Dio, se c'è, sta naturalmente al di là di ogni più estrema conclusione logica o scientifica noi si possa giungere.

Tra un secolo potrebbe darsi che, ricordando la teoria dell'evoluzione, ci si farà una crassa risata ma non certo perché si sarà scoperto che è stato Dio a creare la vita (per un credente già oggi è così e può contemporaneamente credere all'Evoluzione) ma perché si sarà inequivocabilmente dimostrato che è falsa e al suo posto si sarà elaborata un'altra teoria plausibile. Sarebbe da preoccuparsi nel momento in cui non ci fossero più "teorie" ma solo dogmi indimostrati e, soprattutto, indimostrabili.

"In powerful rain, they laid down their heads to die"
(My Dying Bride)
Redazione
Inviato: 14/8/2007 20:05  Aggiornato: 14/8/2007 20:05
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
MORFEO: Non lascio la discussione perchè “voglio avere ragione”, ma perchè mi state dicendo tutto e il contrario di tutto: uno dice che la teoria non può esistere, l’altro mi dice che è stata indicata, ma sono io che non leggo ...

E siccome non amo vedere gli altri che trascinano le discussioni quando sono chiaramene esaurite, cerco almeno di dare il buon esempio. Mica è obbligatorio ritrovarsi sempre d’accordo su tutto.

Tubo
Inviato: 14/8/2007 20:29  Aggiornato: 14/8/2007 20:38
Dubito ormai di tutto
Iscritto: 16/6/2006
Da:
Inviati: 1663
 Re: Gli anelli mancanti continuano ad aumentare
Ciao Massimo, si può anche lasciare che la discussione continui, no?

P.s: scusa l'OT ma è da un annetto quasi che non si parla delle missioni Apollo, perchè non intavoliamo una discussione seria?

Nei forum s'è visto che non funziona, ma un articolo in home non sarebbe male no?

Le missioni Apollo sono il secondo cavallo di battaglia di LC, giusto?
Quindi io direi che ci vorrebbe un articolo in cui tu potresti chiarire bene quali sono le cose che ti fanno dubitare della loro autenticità, punto per punto in maniera esaustiva.

Lo facciamo?
E' estate e forse con un minor numero di utenti connessi ( per forza di cose) riusciremmo ad arrivare a delle conclusioni comuni.
Non pensi?

Ciao.

olah
Inviato: 14/8/2007 21:07  Aggiornato: 14/8/2007 21:17
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
MORFEO: Non lascio la discussione perchè “voglio avere ragione”, ma perchè mi state dicendo tutto e il contrario di tutto: uno dice che la teoria non può esistere, l’altro mi dice che è stata indicata, ma sono io che non leggo ...

E siccome non amo vedere gli altri che trascinano le discussioni quando sono chiaramene esaurite, cerco almeno di dare il buon esempio. Mica è obbligatorio ritrovarsi sempre d’accordo su tutto.


La discussione ha riguardato anche un po' troppi argomenti, spaziando dall'origine della vita all'evoluzione dei primati.

Questo in parte è dovuto a un vizio d'origine: nell'articolo hai messo insieme, in un solo paragrafo, sintesi degli aminoacidi, genetica, paleontologia, darwinismo, origine della specie umana... poi hai condito il tutto con un altro articolo di un turco molto fantasioso che anche lui spaziava parecchio in una specie di delirio tra statistica e una sua visione molto personale della biochimica.

Chiaro che si è creata un po' di confusione. magari mentre qualcuno parlava di teorie abiotiche altri parlavano di teorie neodarwiniane sull'evoluzione, altri di teoria calcolo delle probabilità, altri di teoria del caos... non si è parlato di una teoria ma di teorie diverse.

nessuno
Inviato: 14/8/2007 21:23  Aggiornato: 14/8/2007 21:23
Mi sento vacillare
Iscritto: 30/7/2005
Da: Albino (BG) - Bassa Valle Seriana
Inviati: 501
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
In ambito scientifico, così come in tribunale, ciò che non è provato non esiste.


E non bisognerebbe dimenticare che, in scienza come in tribunale, l'assenza di una prova non è equivalente alla prova di un'assenza.

Buona vita

Guglielmo

"Quieremos organizar lo entusiasmo, no la obediencia" - Buenaventura Durruti
Anonimo
Inviato: 14/8/2007 21:32  Aggiornato: 14/8/2007 21:32
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
uno dice che la teoria non può esistere, l’altro mi dice che è stata indicata, ma sono io che non leggo ...


Il fatto è che chi dice che non può esistere, sono illustri scienziati citati da altri (spesso a sproposito).

Chi dice il contrario è qui e pronto a discutere senza la pretesa di voler convincere nessuno.

Ma con la preghiera di un'apertura tale da poter riconsiderare le proprie posizioni.

In soldoni, se Olah sta dimostrando che lui queste cose le studia, è sterile contrapporgli citazioni di scienziati prese da siti anticreazionisti, soprattutto se lui le ha già smontate tutte 3 volte.

Ma OldBoy è un Troll quindi questo è il suo mestiere.

Ma almeno dire: "cacchio ragazzi, messa così mi sa che avete ragione. Non credo che la vita sia venuta fuori dal brodo primordiale, ma di sicuro il turco ha detto una marea di stronzate".

nottrz
Inviato: 14/8/2007 21:54  Aggiornato: 14/8/2007 22:01
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Provo a fare un rapido riassunto delle tesi sostenute dagli "evoluzionisti" (sostenitori o semplici simpatizzanti). Spero possa essere di aiuto per questo thread o anche solo come traccia per future discussioni.

- i calcoli probabilistici sull'evoluzione non hanno senso perche' sono oggettivamente troppo difficili da fare date le conoscenze attuali

- aminoacidi, proteine e altre parti possono esistere in numerosissime versioni differenti pur conservando la stessa funzionalita'

- l'evoluzione degli organismi e' un fenomeno complessivo, non viene fatto un pezzo alla volta ma si sviluppa in modo corale. Anche le singole parti degli organismi si evolvono dalle versioni primitive a quelle piu' sofisticate.

- l'evoluzione darwiniana non funziona totalmente a caso, ma solo parte del meccanismo e' casuale. L'evoluzione non ha uno scopo. [AGGIUNTO]Le mutazioni non sono l'unico strumento per far migliorare la specie, anche la sola ricombinazione fa molto (es. gli incroci che vengono fatti negli allevamenti per vari scopi: aspetto, lana, latte, ecc.).

- non esiste, oggi, una teoria che spieghi dettagliatamente tutti i singoli passaggi evolutivi che hanno portato allo sviluppo dell'uomo. L'evoluzionismo spiega questo percorso con maggior precisione su alcuni passaggi mentre altri vengono descritti piu' grossolanamente. Si suppone che nel tempo la descrizione andra' migliorando, grazie alla scoperta di nuovi fossili, nuovi studi genetici, ecc.

- le teorie del caos/complessita' possono dettagliare/completare la teoria dell'evoluzionismo evidenziando una seconda fonte di ordine (l'altra e' la selezione naturale).

- questo articolo e' molto interessante.

- ci sono tanti aspetti del problema che spesso vengono ignorati: trasmissione orizzontale di geni, preadattamento, ecc.

- gli algoritmi genetici, e altre simulazioni, funzionano perfettamente grazie ai soli meccanismi descritti dall'evoluzionismo.

- la questione dio e' sempre complicata.


Su queste tesi invece c'e' un po' di disaccordo

- la comparsa della vita non c'entra nulla con l'evoluzionismo -vs- le due cose sono legate

- le teorie del caos/complessita' potranno forse fornire qualche indicazione per spiegare la comparsa della vita -vs- forniscono delle spiegazioni molto convincenti


Segnalatemi se trovate qualcosa che manca/non vi quadra.

Oldboy
Inviato: 14/8/2007 21:58  Aggiornato: 14/8/2007 21:58
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Morfeo,
mi stupisce vedere che sei iscritto da ormai un anno a questo sito.

Io sono molto più "giovane", in questo senso, ma ho letto tutte le discussioni precedenti.
(Forse a te sono sfuggite, in tutto questo tempo?)

In tutte, altri iscritti hanno sostenuto le mie stesse posizioni. Con argomenti analoghi.
In particolare Santaruina, che mi pare sia fra i più vecchi e benemeriti animatori di questo sito.

Eppure nessuno, allora, insultava e accusava i dissidenti di essere "troll".
(Non sono un grande esperto di Internet, ma dal contesto temo che sia un insulto.)

Mi spiace che il clima sia cambiato, diciamo così.

Anonimo
Inviato: 14/8/2007 22:09  Aggiornato: 14/8/2007 22:10
 Re: Gli anelli mancanti continuano ad aumentare
OldBoy: un troll è colui che se ne infischia della discussione, ma getta solo benzina sul fuoco per fomentare gli animi

Se continui ad usare parole di altri (e sempre ed indenticamente le stesse), estrapolate da ogni contesto, nonostante ti siano state sistematicamente e scientificamente smontate, significa o che non leggi quello che ti dicono gli altri, oppure che non ti importa e getti benzina sul fuoco.

Se non sei in grado di discutere allo stesso livello tecnico di Olah non è una colpa né un demerito, ma almeno abbi l'onestà intellettuale di ammetterlo.

Se peschi a caso dalla rete per cercare di avere ragione, beh, allora è diverso.

Oldboy
Inviato: 14/8/2007 22:17  Aggiornato: 14/8/2007 22:19
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Morfeo,
rispetto la tua opinione, ma ovviamente rispetto ancora di più la mia.

Lasciamo ai lettori, magari ai posteri, di giudicare chi sia qui il dogmatico, chi l'intollerante, e chi (ormai ho imparato il termine) "il troll".

Penso esistano dei moderatori, qui dentro, e tu non sei fra loro.
Dunque astieniti, se non ti spiace, dal recensire ancora i miei messaggi.

Anonimo
Inviato: 14/8/2007 22:23  Aggiornato: 14/8/2007 22:25
 Re: Gli anelli mancanti continuano ad aumentare
Non voglio certo recensirti

Ma se tu chiedi io rispondo, e mi adeguo.

Redazione
Inviato: 15/8/2007 8:47  Aggiornato: 15/8/2007 8:48
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
MORFEO: Qui dentro nessuno da del troll a nessuno. Come non sono ammessi commenti ad personam di qualunque altro tipo. Pensavo che lo sapessi.

La discussione può continuare ovviamente all'infinito, ma sempre nel rispetto delle nostre regole.

nottrz
Inviato: 15/8/2007 13:11  Aggiornato: 15/8/2007 13:11
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Forse la discussione e' gia' chiusa, ma mi sembra siano rimasti aperti troppi temi sui quali sono state dette troppe cose inesatte. Visto che ritengo che la prima pagina di LuogoComune sia una vetrina importante mi sento quasi in dovere di cercare di far chiarezza su cose che ritengo false. Lo stesso principio che probabilmente ha portato alla scrittura dell'articolo da cui siamo partiti.


Gli anelli "mancanti"

Googolando un po' li ho trovati: i pesci coi polmoni.
Sono i sarcopterygii.

I Sarcopterygii hanno dato origine a questi due rami

http://en.wikipedia.org/wiki/Coelacanth
http://en.wikipedia.org/wiki/Rhipidistia

Di questi ultimi fanno parte i Lungfish, letteralmente Pescepolmone.
E, in un altro ramo, questi

http://en.wikipedia.org/wiki/Ichthyostega

trovo che questa figura sia interessante anche se poco dettagliata

http://en.wikipedia.org/wiki/Image:Fishapods.jpg

Girando per wikipedia da quelle parti si possono trovare un sacco di altri esempi.

Questo per quanto riguarda il passaggio pesce/rettile.

Per quanto riguarda quello rettile/uccelli viene sempre citato il mitico

http://www.talkorigins.org/faqs/archaeopteryx/info.html

spesso lasciando credere che sia l'unico esempio di forma di transizione.
In realta' ne abbiamo diversi altri, per esempio tutto il gruppo dei dromaeosauridae, dove troviamo Microraptor, Cryptovolans, Sinornithosaurus e Jinfengopteryx, Pedopenna e finalmente lui l'Archaeopteryx.

Quale venga esattamente prima e quale dopo in molti casi e' ancora dibattuto.

Forse sono io che ho il paraocchi, ma a me sembra che la diatriba degli anelli mancanti la si possa anche archiviare.

Per quanto riguarda i primati, e tutte le specie piu' recenti, essendo comparsi da pochissimo tempo, di fossili ce ne sono ancora meno.
Di Archaeopteryx ne sono stati trovati solo 8 e la datazione e' 150/155 milioni di anni fa (ovviamente l'aespetto rilevante e' quanto a lungo siano vissuti come specie, e non da quanto tempo siano comparsi. Ovviamente una specie comparsa di recente puo' essere vissuta al piu' da allora a oggi).
Qui c'e' un bell'elenco dei fossili di primati trovati

http://en.wikipedia.org/wiki/List_of_hominina_fossils

e i primi risalgono a 4 milioni di anni fa.


Esperimenti falliti

Per quanto riguarda poi gli esperimenti falliti segnalo solo che nel Cambriano si stima si siano formati circa 100 phyla distinti. Per capirci, un phylum e' il macrogruppo che comprende i vertebrati. Altri phyla sono quelli degli artropodi, nematodi, ecc. Oggi nel abbiamo solamente 32.
Questo numero, 100, ovviamente e' stato ricavato dai ritrovamenti fossili di organismi appartenenti a questi phyla "falliti".

Dovrei studiare di piu' per trovare altre informazioni.


Preadattamento

Secondo me un brutto termne che indica quando una caratteristica sviluppatasi perche' vantaggiosa in un senso ad un certo punto diventa vantaggiosa in altri termini e si specializza in questa nuova direzione.
Alcuni sostengono che le piume siano comparse sui dinosauri in quanto utili come meccanismo termoregolatore. Altri dettagli dovrei cercarli, pero' immagino che essendo animali a sangue freddo dovessero stare attenti a non congelare/cuocere, in particolare quelli piu' piccoli (ma quest'ultima spiegazione e' fanta-paleontologia che mi sono inventato al momento).
Poi probabilmente le piume si sono rivelate utili per velocizzare la fuga dai predatori o magari nei rituali di corteggiamento e questi tratti sono stato conservati e perfezionati per quello specifico scopo.
Casualmente, magari in seguito ad un cambiamento del proprio ambiente, si sono pero' rivelati utili anche a compiere piccoli salti o brevi voli ed e' uniziata una seconda specializzazione (ad opera di ricombinazione + seleziona naturale) per perfezionare il tratto anche per questo secondo vantaggio.

Come mai i pesci, dal nulla, dovrebbero avere sviluppato dei polmoni? Semplicemente non lo hanno fatto. Data la naturale diversita' tra le singole specie e gli individui, alcuni erano in grado di estrarre una minima quantita' di ossigeno dall'aria. Questi hanno potuto quindi andare in cerca di cibo e trovare riparo anche in quelle zone dove le onde, la siccita'o altro riducono il livello dell'acqua. Col tempo, ricombinazione e selezione naturale (di nuovo niente mutazioni ad hoc) hanno specializzato quella caratteristica.
Intendiamoci, magari qualche mutazione che abbia dato una bella spinta c'e' anche stata, ma non pensiamo alla mutazione che fa apparire i polmoni, quanto piuttosto a quella che rende le cellule dei proto-polmoni 2 volte piu' efficenti nell'estrarre l'ossigeno.

Si sa che per qualunque malattia una percentuale della popolazione e' automaticamente immune. Di certo non perche' si siano evoluti per combattere quella specifica malattia. E nemmeno perche' una mutazione fortunata gli abbia donato quel potere. Semplicemente perche' grazie alle numerose micro differenze casuali che ci sono tra noi quell'agente esterno non riesce ad agire.

Aminoacidi e proteine sono stupidi. Fanno quello che gli capita. Se li metto in contatto con l'aria, cosa mai avvenuta prima, alcune felici cominceranno a fare delle cose. Alcune si legheranno all'ossigeno, altre all'azoto, altre inizieranno a mangiarsi il DNA!. Nei casi piu' gravi, negli organismi evoluti, scatta il sistema immunitario che tenta di arginare i danni o semplicemente il mio pesce comncia a sentirsi male e torna subito nell'acqua.
Le proteine che invece vogliono proprio legarsi all'ossigeno senza fare danni in giro...bhe, che lo facciano pure, poi si vedra'.


Mutazioni

Non servono mutazioni perche' si allunghi il collo a una giraffa, chiedete ad un qualunque allevatore di cani o mucche che si occupa della riproduzione. In realta' di micro-mutazioni durante il processo di riproduzione e crescita ce ne saranno in giro una tonnellata, molte aggiustate dai meccanismi di autodifesa dell'organismo, altre magari no e la cellula "rotta" viene mangiata dal macrofago di turno. In casi piu' rari l'organismo si ammala o muore.


Salti di complessita'

Due o tre famiglie decidono di andare a vivere da sole in una zona disabitata che trovano particolarmente bella. La vita scorre semplice e tranquilla come puo' avvenire tra un gruppo di amici.
Passano gli anni e tra figli e nuovi arrivi il gruppo si trasforma in un villaggio, cioe' un gruppo umano con compiti distinti, una forma di organizzazione gerarchica, delle strutture condivise (es. chiesa), forme di cassa comune, regole sociali, ecc.
In che momento esatto c'e' stato il passaggio da gruppo di persone a villaggio?
Si puo' pensare che la trasformazione sia stata una lenta progressione, che ci sia stata continuita'. In realta' studiando casi concreti si vede come questi passaggi avvengano con transizioni molto rapide. Al superare di una numerosita' critica (di persone, relazioni, ecc.) e una dimensione fisica alcuni meccanismi cambiano. Non e' piu' vero che tutti conoscono tutti, le informazioni diventano mediate, quindi la collaborazione basata sulla reciproca conoscenza non puo' piu' operare, ecc.
Nessuno ha centralmente deciso che le cose dovessero cambiare e la direzione da prendere, semplicemente il sistema si e' riorganizzato. Ma le persone sono le stesse di un anno fa, non e' certo colpa degli ultimi 2 arrivati il grande cambiamento.

Questo non avviene per il fatto che le persone sono esseri perfettamente razionali e decidono collettivamnte cosa fare. La maggior parte delle piccola trasformazioni avviene come conseguenza globale di scelte fatte in modo autonomo e spesso egoistico da parte di ogni singolo individuo.
Questa ricerca individuale, della propria soddisfazione nel caso dell'uomo, porta a far comparire regole collettive che nessuno ha esplicitamente deciso.

Col passare del tempo tutti questi aspetti si raffinano e ad un certo punto subiscono ancora dei salti di qualita': le regole solciali diventano leggi, la cassa comune diventa tasse dello stato, compare il denaro in modo esplicito e attorno a questi nuovi elementi si sviluppano nuove professioni, nuove leggi, nuovi spazi condivisi, che entrano in relazione (conflitto, cooperazione, ecc.) con quelli precedenti. Le leggi all'inizio riguardano solo una minima parte delle relazioni umane, ma una volta scoperto il meccanismo questo si sviluppa rapidamente in altre direzioni.

Questo, si sta rilevando sperimentalmente, avviene per tutti i sistemi. Dai formicai, alle citta', alla crescita dei batteri, arrivando anche a simulazioni con regole semplicissime, prive di certo di qualunque "logica" riconoscibile, che danno origine a strutture e comportamenti complessi.
Nelle simulazioni in cui c'e' piu' "spazio combinatorio" i comportamenti che emergono sono piu' ricchi e strutturati.

Il semplice aumento quantitativo porta a cambiamenti qualitativi tramite trasformazioni rapide. Questo perche' cambiano le logiche di comunicazione (tra umani, formiche o cellule che siano), cambiano le caratteristiche fisiche (le cellule sul bordo saranno piu' esposte all'ambiente (ferite, freddo, ecc.) di quelle all'interno, cambia il ruolo che si ha nell'ambiente (se cresco molto cambiano le mie prede/predatori, il mio fabbisogno energetico, la dispersione di calore, ecc.) e cosi' via.
Nessuno dice alle cellule all'interno di corazzarsi meno di quelle esterne, non c'e' la necessita' di un coordinamento centrale per ottenere tutta una serie di comportamenti collettivi che derivano solo da micro-decisioni locali.

Questo, che ho raccontato in modo soft, e' il "meccanismo" che penso possa rafforzare l'ipotesi evoluzionista (auto-organizzazione).

Redazione
Inviato: 15/8/2007 14:10  Aggiornato: 15/8/2007 14:12
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
NOTTRZ - Ti ringrazio per questo ultimo sforzo, e per la correttezza che hai mostrato in tutta la discussione.

Purtroppo l'argomento è talmente difficile da abbracciare, che si fatica addirittura a trovare una visione unitaria da cui partire tutti insieme. Figuriamoci poi arrivare ad un punto di accordo.

Tu vedi molto bene i passaggi che hai descritto, ed evidentemente ti soddisfano in pieno, mentre io li considero un miliardesimo circa del problema.

E' evidente che ciascuno cerca dalla discussione risposte diverse, e continua quindi a trovare solo le proprie.

Alla prossima, magari su un argomento un pochino più addomesticabile.

Massimo

Oldboy
Inviato: 15/8/2007 17:48  Aggiornato: 15/8/2007 19:21
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Nottrz,

scusa ma ti sbagli di grosso su quasi tutto: dai presunti "anelli di congiunzione" (che in realtà non ci sono) all'idea che - chissà perché - la diatriba possa essere "archiviata".

Forse non l'hai saputo, ma è da un pezzo che il mitico Archaeopteryx non è più considerato un anello di congiunzione fra rettili e uccelli.

L'Archaeopteryx era, semplicemente, un uccello.

Il fatto che avesse denti e artigli aveva tratto in inganno gli studiosi, facendo loro credere che fosse, appunto, una via di mezzo fra un rettile e un uccello.
Ma oggi tutti gli studiosi (anche evoluzionisti) concordano: non aveva nulla a che fare con i rettili.

Dice il paleontologo Carl O.Dunbar:

"In ragione delle sue ali, l'Archaeopteryx deve essere chiaramente classificato come un uccello".

Nel 1992, infatti, si è scoperto un settimo esemplare di questo uccello estinto, e si è capito che:

- Aveva lo sterno come tutti gli altri uccelli, e quindi era perfettamente in grado di volare;

- La struttura delle sue penne era identica a quella degli altri uccelli;

- Era a sangue caldo, come tutti gli altri uccelli.

Insomma, l'Archaeopteryx non è più considerato un anello di congiunzione fra rettili e uccelli.

L'equivoco era nato perché l'animale aveva denti e artigli.
Ma questo non toglie che fosse un uccello - ormai lo si è capito - e non un rettile.
Infatti esistono, o sono esistiti, altri uccelli con denti e artigli.
(Che però erano solo e soltanto uccelli, e non avevano nulla di rettiliano...)

Per esempio: nel 1995 in Cina è stato scoperto un altro uccello fossile, il Confuciusornis.
Il quale, guardacaso, aveva artigli sulle ali, proprio come l'Archaeopteryx.

Quindi disilluditi: anche l'Archaeopteryx è un ex-anello di congiunzione...
Un altro mito evoluzionista, sfatato dalle ultime acquisizioni della scienza.

olah
Inviato: 15/8/2007 18:00  Aggiornato: 15/8/2007 18:01
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
nottrz, per completezza faccio giusto un'aggiunta: il Gogonasus, un pesce di quasi 400 milioni di anni fa con pinne muscolari comprendenti radio ulna e omero (le ossa del braccio umano, per intenderci) ben formati, di fatto un pesce con le zampe. Ha anche grandi aperture nel teschio per la respirazione.

Poi c'è il Tiktaalik rosae, un altro pesce estinto che ha uno scheletro simile a quello degli anfibi.

I dipnoi invece (pesci polmonati) probabilmente sono un caso di evoluzione parallela. Non è neanche detto che i primi anfibi avessero i polmoni.

Oldboy
Inviato: 15/8/2007 18:15  Aggiornato: 15/8/2007 18:24
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Ma il punto è che in natura non esistono meccanismi in grado di trasformare una specie in un'altra.

Il fatto che alcuni pesci abbiano i polmoni non dimostra nulla a rigor di logica, se non il dato - tautologico - che alcuni pesci hanno i polmoni.

Ma l'inverosimile passaggio dal pesce al rettile è ancora tutto da dimostrare, perché un tale meccanismo non è ancora stato individuato.

I pesci sono programmati per vivere tutta la loro esistenza sott'acqua: quasi tutti i loro organi sono diversi da quelli degli animali terricoli.
L'inverosimile trasformazione degli uni negli altri aspetta ancora di essere provata in modo plausibile.
(Cioé senza sfidare a un tempo la ragione, la logica e il buon senso...)

Le congetture non bastano più.

E' evidente che un pesce troppo ambizioso, volendo traslocare sulla terra ferma, rimarrebbe impigliato nella trappola della "complessità irriducibile".
(Preparata dal professor Michael Behe.)

E dovrebbe quindi rassegnarsi a conservare la sua residenza marina...

olah
Inviato: 15/8/2007 18:42  Aggiornato: 15/8/2007 18:42
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Un'altra curiosità: nel 2005 è stato scoperto un decimo fossile di Archaeopteryx molto interessante. La scoperta è stata pubblicata su Science del 2 dicembre 2005 ( http://www.sciencemag.org/cgi/content/short/310/5753/1483 ) con un articolo intitolato "A Well-Preserved Archaeopteryx Specimen with Theropod Features".

Questo fossile ha un cranio ben conservato che ha permesso per la prima volta l'osservazione dall'alto. Si è scoperto così che un osso palatino ha caratteristiche tipiche dei dinosauri, poi scomparse negli uccelli.

Anche le dita hanno diverse caratteristiche dei dinosauri. Ad esempio il secondo dito dell'arto posteriore consente il ripiegamento dell'unghia verso l'altro, come nel dinosauro teropode Deinonychus, mentre negli uccelli il ripiegamento è verso il basso.

Allego l'abstract dell'articolo:

Citazione:
A nearly complete skeleton of Archaeopteryx with excellent bone preservation shows that the osteology of the urvogel is similar to that of nonavian theropod dinosaurs. The new specimen confirms the presence of a hyperextendible second toe as in dromaeosaurs and troodontids. Archaeopteryx had a plesiomorphic tetraradiate palatine bone and no fully reversed first toe. These observations provide further evidence for the theropod ancestry of birds. In addition, the presence of a hyperextendible second toe blurs the distinction of archaeopterygids from basal deinonychosaurs (troodontids and dromaeosaurs) and challenges the monophyly of Aves.

Oldboy
Inviato: 15/8/2007 18:56  Aggiornato: 15/8/2007 19:23
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Il mito evoluzionista, per cui gli uccelli deriverebbero dai rettili, comincia sgretolarsi anche dalle più alte cattedre.

Uno dei più autorevoli ornitologi del pianeta, il professor Alan Feduccia dell'Università della North Carolina, dice:

"Ho studiato il cranio degli uccelli per venticinque anni, e non trovo alcuna similitudine con i rettili.
Non la vedo...
L'origine degli uccelli dai dinosauri sarà, a mio giudizio, il maggiore motivo di imbarazzo per la paleontologia del XXI secolo."

Infatti, si sono scoperti molti fossili di antichi uccelli contemporanei all'Archaeopteryx.
(Il presunto, ormai screditato "anello di congiunzione" fra rettili e uccelli.)

Un esempio è il Confuciusornis, scoperto in Cina nel 1995.
Visse nella stessa epoca dell'Archaeopteryx, ed era in tutto e per tutto un uccello.

Ne deriva che esistevano già molte specie di uccelli, nell'epoca della presunta evoluzione dai rettili agli uccelli stessi.

Come sempre, le congetture dell'evoluzionismo restano tali: sempre più screditate con il progredire della conoscenza scientifica.

olah
Inviato: 15/8/2007 19:00  Aggiornato: 15/8/2007 19:13
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Visto che ci sono e nottrz sembra interessato all'argomento faccio un'altra aggiunta: è possibile che i primi pesci anfibi respirassero attraverso la pelle, oppure attraverso organi specializzati, tipo l'organo labirintiforme, posto dietro le branchie, dei pesci anabantoidei che respirano l'aria atmosferica.

olah
Inviato: 15/8/2007 19:08  Aggiornato: 15/8/2007 19:08
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Anche la vescica natatoria può funzionare come sacco polmonare, utile per i pesci che vivono in aree soggette a prosciugamento.

Oldboy
Inviato: 15/8/2007 19:47  Aggiornato: 15/8/2007 19:59
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Nottrz scrive testualmente:

"Non servono mutazioni perché si allunghi il collo a una giraffa, chiedete a un qualunque allevatore di cani o mucche".

Questo è uno dei più grossolani errori di Darwin (poi ereditato, purtroppo, da quasi tutti gli evoluzionisti).

Darwin credeva, infatti, che all'interno di una specie le possibiltà di variazione fossero illimitate.

Sir Charles credeva plausibile perfino che le balene discendessero da una razza di orsi che, un bel giorno, si erano trasferiti nel mare, trasformandosi così in cetacei...
(Sembra una barzelletta, ma così è scritto nel sacro testo "L'Origine della specie".)

Ma è proprio "chiedendo a qualsiasi allevatore", come Nottrz suggerisce di fare, che vedremmo totalmente confutata quella bislacca ipotesi.

Infatti le possibilità di variazione intraspecifica non sono affatto illimitate, al contrario di ciò che raccontava Darwin.
Qualsiasi allevatore, o coltivatore, ci dirà che è possibile sì indurre variazioni, ma sempre entro precisi, invalicabili limiti.

Raggiunti quei limiti, l'animale (o la pianta) tenderà inesorabilmente verso il tipo originario, e non sarà più possibile forzarlo verso altre variazioni.

Ogni specie resta sempre quella che è, per quanto abile o mefistofelico sia l'allevatore.
Prove del contrario non ce ne sono: come sempre le fantasiose congetture degli evoluzionisti restano prive di riscontri.

Anonimo
Inviato: 15/8/2007 20:18  Aggiornato: 15/8/2007 20:18
 Re: Gli anelli mancanti continuano ad aumentare
Olah ci sono anche io, ed è davvero da encomio solenne il vostro lavoro.

nottrz
Inviato: 15/8/2007 21:12  Aggiornato: 15/8/2007 21:12
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Massimo: speriamo che a chi ha seguito la discussione siano nati un po' di dubbi o che abbia scoperto qualcosa di nuovo (io personalmente ho scoperto un sacco di cose).
Alla prossima :)


OldBoy:
Citazione:

Dice il paleontologo Carl O.Dunbar:


Per me va bene proseguire le discussione a patto di non ridurla ad una battaglia di "grandi nomi autorevoli".
Il paleontologo da te citato sostiene la sua tesi. Nel documento da me indicato altri paleontologi sostengono invece che l'archaeopteryx abbia numerosi tratti da rettile (ne indicano addirittura 18).
Mi sembra di capire che ne' io ne' te abbiamo mai avuto sottomano un fossile di archaeopteryx e che comunque non avremmo forse nemmeno le competenze specifiche per analizzarlo e quindi neppure quelle per valutare nel dettaglio le affermazioni dei diversi paleontologi.
Quindi ti propongo di cercare di circoscrivere la discussione a cose dove nel nostro piccolo possiamo dire qualcosa.
Anche i dromaeosauridi secondo te non sono da considerare anelli di congiunzione?

http://en.wikipedia.org/wiki/Dromaeosauridae

Questi sono dinosauri con tratti da uccelli. Prendo questo come esempio

http://en.wikipedia.org/wiki/Beipiaosaurus

mi sembra chiaro che si tratta di una forma di transizione. Cosi' come questi

http://en.wikipedia.org/wiki/Jinfengopteryx
http://en.wikipedia.org/wiki/Achillobator
http://en.wikipedia.org/wiki/Dromaeosaurus

E tra i dromaeosauridi ce ne sono molti altri esempi, ho scelto solo quelli con le figure migliori.
Poi si puo' discutere se siano piu' rettili o piu' uccelli, ma e' proprio il semplice fatto che ci sia questa discussione che li identifica come forme di transizione.
Altrimenti come dovrebbe essere fatta una forma di transizione? Essere esattamente al 50% tra i due? Qui abbiamo un sacco di sfumature.

Pensi che anche le forme di transizioni dei pesci che ho elencato siano da scartare come non significative?

Riguardo al confuciusornis: il fatto che avesse artigli sulle ali potrebbe essere usato anche come argomento a mio favore, non credi?
Inoltre da wikipedia, che non so se accetti come fonte attendibile, il confuciusornis viene datato 120 milioni di anni fa, mentre l'archaeopteryx 150/155 milioni, quindi prima.
In ogni caso il fatto che al tempo dell'archaeopteryx esistessero gia' specie piu' evolute non va in nessun modo contro l'ipotesi evoluzionista.
Non e' che nel momento in cui compare una specie nuova allora improvvisamente tutti i rappresentanti di quella precedente si estinguono o si trasformano in quella nuova. Le due specie continuano a convivere. Poi magari una delle due si estingue, ma quello e' un altro discorso.
Nel caso che credo piu' tipico di speciazione un gruppo della stessa specie viene separato in due sottogruppi da eventi naturali. Da li' ognuno dei due segue il suo percorso evolutivo per conto suo.
Poi non so se qualcuno sostenga che l'archaeopteryx sia un atenato del confuciusornis. E infine gli archaeopteryx li hanno trovati in germania e i confuciusornis in cina. Non e' che l'evoluzione, che si basa in buona parte sulla riproduzione e sulle caratteristiche specifiche del territorio possa ignorare le distanze.

Infine il concetto di "complessità irriducibile".
Behe, uno dei grandi nomi dell'intelligent design, sostiene che alcuni organi, ad esempio l'occhio, non si possono essere formati per passaggi successivi perche' per poter funzionare sono necessari come minimo 3 elementi distinti (la complessita' dell'organo non puo' essere ridotta oltre).
Visto che fino a quando non sono presenti tutti e 3 i tratti l'occhio e' del tutto inutile non c'e' motivo per cui la selezione lo debba aver preservato in attesa della comparsa dei due tratti successivi.
Questo approccio e' gia' stato criticato da diverse persone.
Innanzi tutto si tratta solo di un ragionamento logico, non e' una teoria verificabile sperimentalmente. Quindi puo' essere interessante come spunto di riflessione ma si ferma li'. Non c'e' un criterio preciso per stabilire quali organi sono irriducibili e quali no.
Secondo, impone che lo sviluppo sia per stadi sequenziali e non organico/complessivo (che e' la visione quasi universalmente accettata di recente). Prima si deve formare un cristallino ben formato, magari non perfetto ma a buon punto. Poi la retina, ecc.
Terzo, ignora il concetto di preadattamento.

Circa la questione allevamenti: mi citi qualche fonte? Di quante generazioni stiamo parlando?
Su piccola scala sono d'accordo con te, se pero' provassimo per qualche milione di anni, con qualche migliaio di mucche in parallelo tutte selezionate in una stessa direzione secondo me vedremmo un sacco di cose strane. Solo che sarebbe probabilmente impossibile distinguere quali sono i contributi della sola ricombinazione da quelli delle mutazioni (a meno di massive analisi del dna).

Parentesi: nessuno considera sacro il libro di Darwin tranne forse i creazionisti che, essendo stato scritto piu' di 100 anni fa, lo trovano come facile bersaglio ignorando tutto quello che e' successo nel frattempo in pressoche' tutti i campi di ricerca...
A parte la nota polemica, non sono parente di Darwin e nessuno mi paga per difenderlo. Trovo che la sua teoria sia convincente e le critiche poco consistenti, niente di "sacro" insomma.


olah:
grazie per gli altri riferimenti, spero interessino anche altri e non solo me :)
Carini gli anabantoidei.

sitchinite
Inviato: 15/8/2007 23:46  Aggiornato: 15/8/2007 23:46
Sono certo di non sapere
Iscritto: 3/6/2007
Da: Roma - Pomezia
Inviati: 3270
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:

Fino a che non si dimostra che nell'universo è impossibile che la vita si sia formata spontaneamente bisogna stare scientificamente zitti oppure dire semplicemente che si crede, si ha fede in un Creatore (di qualunque genere sia).


Questo vale anche per gli evoluzionisti...
finchè non proveranno che la vita si è formata spontaneamente dovrebbero stare scientificamente zitti oppure dire che loro 'credono'.

E finora non hanno provato niente, non sono nemmeno tutti d' accordo tra di loro...

Anonimo
Inviato: 15/8/2007 23:51  Aggiornato: 16/8/2007 0:19
 Re: Gli anelli mancanti continuano ad aumentare
Oh Nottrz ma che bella cosa hai tirato in mezzo, l'evoluzione dell'occhio!

Prima dico la mia: non credo che l'occhio per funzionare debba per forza essere completo.

Poniamo un po' di solide ed INATTACABILI basi.

Prima di tutto la retina è considerata Sistema Nervoso Centrale.

Il nervo ottico NON è alla stregua di tutti gli altri nervi, infatti è avvolto nelle meningi, quindi è di fatto un prolungamento del cervello stesso (come il nervo olfattivo).

E già questo...

L'uomo ha due tipi di recettori per la luce, i coni ed i bastoncelli. I bastoncelli sono quelli atti alla visione crepuscolare, tanto che vedono solo in bianco e nero (ve ne accorgete quando cercate due calzini dello stesso colore con poca luce).

In questi recettori c'è una proteina (sempre loro!) la rodopsina a cui basta essere colpita da UN SINGOLO FOTONE, per mutare la sua forma da -cis a -trans, e dare il via così all'atto della visione.


A me già questo basta per avere un qualcosa che mi fa capire se è giorno o notte. Senza bisogno di tutto il sistema ottico anteriore. Una proteina che reagisce alla luce a contatto diretto con i centri nervosi. Più funzionale di così!

Ci sarebbero tante cose da dire, tipo i recettori messi non verso la luce ma al contrario, contro uno sfondo di MELANINA, che abbassa enormemente la quantità di luce che effettivamente li colpisce.

Un disegnatore intelligente avrebbe usato recettori meno sensibili (e quindi a più basso "costo") orientandoli nel verso giusto, piuttosto che usarne di tanto sensibili e farci arrivare la luce dopo riflessione su uno sfondo che la assorbe.

E come se facessi fotografie usando una pellicola ad alta sensibilità per poi mettere davanti all'obiettivo un filtro nero. A che pro?

Se non è adattamento questo, utilizzando le vecchie scorte di magazzino...


Poi voglio farvi leggere qualcosa che ho trovato in seguito:

Questo credo sia molto interessante:
Evoluzione dell'occhio

E questo è bellissimo!
Spettro visibile

Anonimo
Inviato: 16/8/2007 0:04  Aggiornato: 16/8/2007 0:22
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Questo vale anche per gli evoluzionisti...finchè non proveranno che la vita si è formata spontaneamente dovrebbero stare scientificamente zitti oppure dire che loro 'credono'.


Stare "scientificamente zitti" significa non dire stupidaggini mettendo su dimostrazioni sulle basse probabilità costruite su errori ed ignoranza.

Mi sa che il nocciolo della discussione in questi commenti ancora non è chiaro.

Non vedo nessuno qui dentro che stia difendendo a spada tratta l'evoluzionismo né la nascita della vita dal brodo primordiale.
C'è chi, nel suo piccolo, sta solo avvisando che molte dimostrazioni che i "creazionisti" usano contro gli "evoluzionisti" sono errate.

Tutto qui.

E' come se tu venissi qui a dirmi che la terra è piatta perché così la vede il tuo occhio.
Io ti dico "beh forse il tuo occhio non basta"
E tu mi dici "Allora dimostrami che è sferica".
Io ti direi: "Non sono in grado di dimostrartelo, anche perché per me può benissimo essere piatta ma so per certo che il tuo occhio non basta per dire che è piatta, per questo, questo e quest'altro motivo."

"Ah vedi non sai dimostrarmelo... allora è piatta!"

Ed io così: O_O

Oldboy
Inviato: 16/8/2007 0:25  Aggiornato: 16/8/2007 0:25
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Che la terra non sia piatta è stato ampiamente dimostrato, non con le congetture ma con i fatti.

La cosiddetta "evoluzione", al contrario, aspetta ancora di essere dimostrata, al di là delle congetture e delle fantasticherie.

La storiella dell'occhio che si sarebbe sviluppato "gradualmente", tanto per cambiare, è priva di qualsiasi riscontro probatorio.
Ma, certo, la scusa è bell'e pronta: solo le parti dure degli animali si fossilizzano, le altre no.

Dunque, via libera all'inventiva, l'arma principale degli evoluzionisti...

sitchinite
Inviato: 16/8/2007 0:28  Aggiornato: 16/8/2007 0:28
Sono certo di non sapere
Iscritto: 3/6/2007
Da: Roma - Pomezia
Inviati: 3270
 Re: Gli anelli mancanti continuano ad aumentare
a mio avviso il paragone non sta in piedi perchè fatto tra una cosa oggettivamente dimostrabile in qualsiasi momento (la rotondità della terra) e una cosa sulla quale si possono solo fare teorie (l' origine ed evoluzione della vita).
E quando si fanno teorie si devono raccogliere indizi, catalogarli, distinguere tra quanti assecondano una data teoria e quanti invece la confutano.
La teoria se é valida deve trovare una spiegazione per quegli indizi che la confutano.
Se una teoria dice che una evoluzione é stata graduale attraverso selezione naturale che ha prodotto stadi intermedi, prima o poi quegli stadi intermedi vanno trovati...
se una teoria dice che invece ci son stai dei 'salti', deve anche definire quanti sono, se son stati 'localizzati' o globali, e spiegare come possono essere stati globali e tutti nella stessa direzione...
Deve spiegare perchè alcune specie si son evolute e altre no.
E deve spiegare tante altre cose.
Se non riesce a fornire spiegazioni valide la si può considerare una teoria valida?
La si può prendere a modello?
In base a cosa?
La obiezione più grande all' intelligent design o al creazionismo in genere é questa: se un creatore ha creato noi, chi ha creato lui?
A mio avviso si potrebbe rispondere 'un altro creatore precedente'.
Sarebbe un continuo, dovremmo immaginare un creatore iniziale... oppure no...
in questi anni si sta sviluppando la teoria dell' universo multidimensionale, o multiverso, attualmente solo a livello di speculazione ma son sempre più gli scienziati che la considerano verosimile.
Se si ammette un multiverso, cioè piani al di fuori di quelli in cui noi agiamo, si può ammettere anche l' idea di un creatore che da un livello più alto abbia operato nel nostro.
Senza tirare in ballo spiegazioni multidimensionali... ti invito a fare un paragone proprio con l' universo in cui ci troviamo.
Abbiamo una teoria del big bang reputata valida, ma niente ci spiega COSA ci fosse prima del big bbang.
Ci viene detto 'un ammasso di materia con volume infinitesimale e densità pressoche infinita'.
Si ma dove era contenuta?
Come vedi esiste ALMENO una altra teoria senza 'inizio' oltre a quella creazionista.
A me sembra abbastanza per non escluderla a priori.

Anonimo
Inviato: 16/8/2007 0:48  Aggiornato: 16/8/2007 0:56
 Re: Gli anelli mancanti continuano ad aumentare
Naturalmente l'esempio della terra piatta era un ipotetico discorso fatto tra due persone in un'epoca in cui non si conosceva ancora la forma della Terra (ma anche qui...), quindi non era "immediatamente dimostrabile".

Ma la cosa principale è un'altra: ERA UNA METAFORA!
(Che ha colto perfettamente nel segno a quanto pare...)


Dov'è lo smile che si picchia in testa?

Citazione:
Come vedi esiste ALMENO una altra teoria senza 'inizio' oltre a quella creazionista.A me sembra abbastanza per non escluderla a priori.


Ma chi è che la sta escludendo!?!?! Davvero devo autocitarmi?

"Non vedo nessuno qui dentro che stia difendendo a spada tratta l'evoluzionismo né la nascita della vita dal brodo primordiale.
C'è chi, nel suo piccolo, sta solo avvisando che molte dimostrazioni che i "creazionisti" usano contro gli "evoluzionisti" sono errate.
Tutto qui."


Voglio piangere...


Fabrizio70
Inviato: 16/8/2007 8:02  Aggiornato: 16/8/2007 8:02
Sono certo di non sapere
Iscritto: 18/5/2006
Da: Roma
Inviati: 3721
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Dunque, via libera all'inventiva, l'arma principale degli evoluzionisti...


Oldboy visto che ritieni l'evoluzione una fantasia spiega a parole tue come é andata....

P.S:Quando Copernico pubblicò il De revolutionibus orbium coelestium non é che il giorno dopo tutti sono passati a credere all'eliocentrismo , sono passati almeno qualche centinaio d'anni , ed inoltre conteneva errori grossolani , tipo le orbite circolari.....

Il lusso non può mai essere soddisfatto perché, essendo qualcosa di falso, non esiste per esso un contrario vero e reale in grado di soddisfarlo e assorbirlo.
Wilhelm Richard Wagner-1849
Redazione
Inviato: 16/8/2007 9:12  Aggiornato: 16/8/2007 9:12
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
Lungi da me il voler rientare nella discussione, ma rimuginando sul tutto mi si è formato un concetto che non posso non condividere.

Ma vi rendete conto che il caso è molto più bravo di noi? L’uomo non è assolutamente in grado di creare un altro uomo (dalla materia inerte, intendo), mentre il caso sì.

Noi con tutta la nostra scienza, con tutta la nostra intelligenza, con tutta la nostra tecnologia, nemmeno combinando APPOSTA gli elementi chimici siamo in grado di creare qualcosa di vivente – nemmeno un microscopico batterio – mentre lui ha prodotto dozzine di specie di animali superiori senza nemmeno sforzarsi più di tanto. Ha solo ASPETTATO.

Talmente fantastico, che io a questo “Caso” comincerei a mettere la maiuscola. Così, tanto per evitare sorprese...

nottrz
Inviato: 16/8/2007 9:47  Aggiornato: 16/8/2007 9:47
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Oldboy:
Citazione:

La storiella dell'occhio che si sarebbe sviluppato "gradualmente", tanto per cambiare, è priva di qualsiasi riscontro probatorio.


Io potrei anche citarti diversi platelminti dotati di singole cellule fotorecettrici, altri con gruppi di cellule, ecc.
E tutti animali viventi, niente fossili. Ma mi sembra di capire che per te tutto questo sarebbe irrilevante, quindi lascio stare.
In fondo dimostrerebbe solo che esistono animali con occhi con occhi semplici (trovati negli strati piu' antichi), altri con occhi leggermente piu' complessi (datati un po' dopo) e cosi' via.
E' vero', dedurre e' rischioso e arbitrario, ma normalmente si procede cosi'...


sitchinite:
Citazione:

La teoria se é valida deve trovare una spiegazione per quegli indizi che la confutano.


Faccio fatica a seguire questa argomentazione perche' mi sembra che il termine valida sia usata come sinonimo di perfetta.
Che io sappia nessuna teoria riesce a spiegare tutto cioe' che accade nel suo ambito.
La fisica newtoniana non spiega il moto di Mercurio e molte altre cose.
La relativita' va un po' oltre ma non "chiarisce" fenomeni come il paradosso EPR, le rotazione delle galassie e altre cose.
La chimica/fisica non spiegano come mai la gallina faccia uova col guscio di calcio senza assumere calcio.
E la lista e' lunghissima.
Quando si scopre un nuovo elemento si prova a correggere il tiro, se si riesce bene, altrimenti non si butta via tutto quanto in attesa della soluzione. Si aggiunge quell'elemento alla lista dei problemi aperti e si va avanti, magari si aprono dei gruppi di ricerca specifici, ecc.

Secondo tema: che cos'e' una spiegazione? Una teoria "inventa" delle cose. Newton dice che esiste una forza magica che attrae tra loro i corpi a distanza. Uno puo' dirmi che una forza che agisce istantaneamente a distanza e' una scemenza (lo pensava anche Newton...) ma questa non e' una critica alla teoria di Newton, ma un rifiuto a priori delle sue premesse.
Una critica _alla teoria_ dovrebbe accettare, anche se magari non condividere su un piano metafisico, quelli che sono i suoi postulati e vedere se da li' seguono o contraddizioni interne o disaccordo con i dati che la teoria vuole spiegare.
Prendi ad esempio la risposta alla domanda di andal sui fossili viventi: spiega il fenomeno in modo coerente con le premesse della teoria?
Secondo me si', ma la risposta e' delicata da dare. Se si sostiene il contrario bisogna pero' indicare con quale elemento della teoria o con quale dato questa spiegazione e' in contraddizone.
E' chiaro che la risposta che ho dato e' un applicazione _ad hoc_ delle premesse della teoria. Pero' su un caso specifico per forza l'applicazione e' ad hoc.

Non so se condividi queste idee, dette un po' male. Se non le condividi fammi sapere, perche' da queste premesse segue tutto il resto.

Nota: su tutto questo e' ovvio che esistono conflitti personali, economici, politici, religiosi che rendono il processo molto piu' "sporco" di quello descritto qui sopra.

Citazione:

Se una teoria dice che una evoluzione é stata graduale attraverso selezione naturale che ha prodotto stadi intermedi, prima o poi quegli stadi intermedi vanno trovati...


Per questo ti rimando agli ultimi post sul passaggio pesce/rettile e rettile/uccello. Li hai letti? Cosa ne pensi?

Citazione:

Deve spiegare perchè alcune specie si son evolute e altre no.


Vedi scambio con andal. Io penso di aver fornito una possibile spiegazione. E' proprio quella _vera_? Non lo so e in senso stretto non lo sapremo mai. Potremmo magari col tempo trovarne una piu' convincente, ma a sua volta possiamo essere certi che quella sia quella _vera_?
Secondo me e' importante che all'interno della teoria esista almeno una spiegazione coerente di quel fenomeno.

Poi, nelle realta' specifiche ci sono sempre le stranezze: potrebbero esserci scenari da b-movie dove il pesce e' rimasto congelato per milioni di anni
(scherzo!). La teoria descrive l'andamento tipico, quello di riferimento, poi andrebbe calata sulla singola realta'.

Citazione:

Se non riesce a fornire spiegazioni valide la si può considerare una teoria valida?


Non vorrei turbare i sonni di nessuno, ma in fondo e' solo una questione di quantita'. Quante spiegazioni valide fornisce? Quanti fenomeni lascia irrisolti? Ci sono candidati migliori? E non parlo solo dell'evoluzionismo, ma di tutte le teorie.
Tutto qua...

Citazione:

Abbiamo una teoria del big bang reputata valida, ma niente ci spiega COSA ci fosse prima del big bbang.


Se si accettano le premesse e il contenuto stesso di quella teoria tempo e spazio si sono creati con il big bang. Prima non c'erano. Non c'era proprio il concetto di dove e quando. Puo' non piacere, puo' disorientare, ma la teoria sostiene proprio questo.
Chiedersi cose ci fosse prima vuol dire rifiutare in blocco la teoria.

Con le teorie scientifiche il gioco del "perche'" non funziona. Perche' la mela cade? Per la forza di gravita'. E perche' c'e' la forza di gravita'? Perche' si'.
In realta' la forza di gravita', come modello, c'e' come _conseguenza_ del fatto che la mela e' caduta, ma qui apriamo tutto un altro tema.

Citazione:

La obiezione più grande all' intelligent design o al creazionismo in genere é questa: se un creatore ha creato noi, chi ha creato lui?


Il creatore quasi sempre per definizione e' eterno, quindi non ha senso chiedersi chi lo abbia creato o cosa ci fosse prima di lui. Quasi lo stesso discorso del big bang.
Qui il gioco del perche' si puo' fare e la religione vince :)


Fabrizio70:
Citazione:

Oldboy visto che ritieni l'evoluzione una fantasia spiega a parole tue come é andata....


Ottima domanda :)

Clorofilla
Inviato: 16/8/2007 9:48  Aggiornato: 16/8/2007 9:48
Mi sento vacillare
Iscritto: 6/7/2006
Da:
Inviati: 859
 Re: Gli anelli mancanti continuano ad aumentare
Da uno scienziato che dice queste cose sulla vita credo sia difficile allora avere dichiarazioni di questo tipo:

http://www.ecplanet.com/canale/salute-7/ricerche-52/0/0/7110/it/ecplanet.rxdf

Sta parlando di vita dallo spazio!!! Mi sembra ci sia una palese differenza fra dire che la vita è impossibile, nessun brodo da nessuna parte e poi parlare di batteri e virus che arrivano dallo spazio. Ho pure dubbi che l'astronomo creda nel disegno intelligente.
Per quanto posso capire, sembra appoggi la teoria della Panspermia insieme ad Hoyle.

Ho sempre più il sospetto, se non la certezza, che certe fonti siano davvero mistificate. Non è strano l'apparire come funghi di scienziati che con loro (presunte) dichiarazioni vanno contro la scienza ed il loro ruolo??? Sento puzza di bruciato....

nottrz
Inviato: 16/8/2007 10:13  Aggiornato: 16/8/2007 10:13
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Massimo, se te la dico cosi' suona meglio?

Un processo parzialmente casuale, massivamente parallelo, durato milioni di anni ha prodotto quello che noi in...ehm...un migliaio di tentativi non siamo riusciti a fare.

E con massivamente parallelo intendo qualcosa tipo 10 alla 24 molecole per ogni litro d'acqua, visto che sulla terra ci sono 1,3 miliardi di chilometri cubi d'acqua...non farmi fare i conti...

Si chiama brute force :)

Polemica: se destinassero gli stessi fondi dati alla fisica delle alte energie alla ricerca sulla vita di sicuro faremmo qualche progresso in piu'...


Clorofilla:
Ma la SARS non era una psy op? :)

No, nessuno manipola le ricerche scientifiche, non vedere complotti ovunque :)

http://www.ucsusa.org/scientific_integrity/interference/scientists-signon-statement.html

Clorofilla
Inviato: 16/8/2007 10:41  Aggiornato: 16/8/2007 10:41
Mi sento vacillare
Iscritto: 6/7/2006
Da:
Inviati: 859
 Re: Gli anelli mancanti continuano ad aumentare
Nonso dirti al 100% se la Sars esista realmente come virus (presumo di si, visto che anche l'Italia ne parlava me ne frenava comunque la psicosi) o sia stato solo una psy op.

Non è che vedo complotti a tutti i costi o manipolazioni delle richerche, vedo che da più fonti (di solito religiose o ideologiche) arrivano citazioni in continuo di scienziati che si tirano la zappa sui piedi. Il che mi fa pensare che ci siano uno o più mistificatori e che poi ci sia una citazione della citazione ripresa a pappagallo da altri siti per confutare le proprie idee.
E' anche più comodo rimanere attaccati ai soliti tre discorsi, girare sempre intorno a questi che approfondire seriamente la materia.

Clorofilla
Inviato: 16/8/2007 11:18  Aggiornato: 16/8/2007 11:18
Mi sento vacillare
Iscritto: 6/7/2006
Da:
Inviati: 859
 Re: Gli anelli mancanti continuano ad aumentare
Più che il caso in sè come un'entità creatrice ci dobbiamo rifare alle proprietà fisico chimiche della materia e le condizioni favorevoli o sfavorevoli (eventi del caso) che permettono il suo mutare.

Se è vero quello che dicono , sembra che anche nello spazio ci siano amminoacidi e si formino sopratutto nelle nebulose.

http://www.sapere.it/tca/minisite/scuola/astronomia/11.html

nottrz
Inviato: 16/8/2007 11:29  Aggiornato: 16/8/2007 11:29
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Mmm, mi sa che non hai guardato il link :)

E' un petizione firmata da 12mila scienziati, tra cui 60 premi nobel e numerosi altri grossi personaggi dove si sostiene che l'amministrazione Bush usa ricerche false o manipolate.

Io penso che la maggior parte delle critiche all'evoluzionismo nascano in ambito religioso perche', per qualche strano motivo, sono convinti che tra fede e scienza debba esserci un legame.

Poi si e' spostata anche fuori dal mondo clericale e si vanno a pescare riferimenti anche da autori non credenti per sdoganarla un po'.

Io personalmente trovo molto piu' "mistico" il fatto che milioni di particelle si organizzino spontaneamente in modo cosi' straordinario piuttosto che pensare ad un qualcuno (barbuto o meno) che stia li' a dargli una spintarella quando serve.
Come diceva Morfeo in uno dei primi messaggi, l'armonia che vediamo in giro trovo piu' facile che emerga come scoperta/esperienza piuttosto che come risultato predeterminato di un noioso calcolo di un elaboratore o della altrettanto noiosa e antropomorfa mano divina.

Tanto perche' mi sono venuti in mente vi link due video, non sia mai che anche le onde (del mare, sonore, elettromagnetiche) con le loro interferenze possano avere aiutato la materia (cellule e galassie) a strutturarsi secondo certe simmetrie...

http://it.youtube.com/watch?v=sY6z2hLgYuY
http://it.youtube.com/watch?v=NKxKVpHZe5Q
http://it.youtube.com/watch?v=_bAmjRK9wBA

Belli vero? :)
I miti piu' antichi non dicono forse che tutto si e' formato dalla musica?


P.S.
Le psy ops possono avere una componente fisica anche rilevante, vedi 911

sitchinite
Inviato: 16/8/2007 11:51  Aggiornato: 16/8/2007 11:51
Sono certo di non sapere
Iscritto: 3/6/2007
Da: Roma - Pomezia
Inviati: 3270
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
I miti piu' antichi non dicono forse che tutto si e' formato dalla musica?


Me ne segnali qualcuno?
Anni fa avevo letto un libro x ragazzi che descriveva miti del genere, affascinantissimi, ma non ricordo l' autore...
se hai qualche link in merito é molto benaccetto...

Clorofilla
Inviato: 16/8/2007 11:58  Aggiornato: 16/8/2007 11:58
Mi sento vacillare
Iscritto: 6/7/2006
Da:
Inviati: 859
 Re: Gli anelli mancanti continuano ad aumentare
L'articolo l'ho letto dopo che ho postato. Mea culpa.

ulivinico
Inviato: 16/8/2007 14:49  Aggiornato: 16/8/2007 14:49
Ho qualche dubbio
Iscritto: 19/10/2006
Da:
Inviati: 38
 Re: Gli anelli mancanti continuano ad aumentare
Caro Massimo Mazzucco,
non capisco il perché di post con questi toni che sembrano quasi religiosi. Per fortuna capisco che questo non è un sito cattolico ma questo dubitare dell'evoluzione mi sconcerta.
Non voglio dire che ci sono molte certezze sulla vita ma visto che abbiamo il 99.4% di DNA identico allo schimpanzè possiamo intanto affermare che l'evoluzione è una certezza.
Per quanto riguarda i dubbi su altri aspetti uno dei grossi problemi di queste discussioni è CHE TUTTI VOGLIONO RISPOSTE SUBITO!!
La scienza non ha fretta. Proprio la settimana scorsa a Turisti per caso (Evoluti per caso) hanno mostrato nuove scoperte su uomini di 50mila anni fa in Brasile, che quindi non sono quelli che sono passati dallo stretto di Bering. Queste scoperte cambiano storia e dizionari e più che altro potrebbero portare a scoprire che ci sono state evoluzioni parallele. Sono aspetti da scoprire..vedremo.
Quello che mi infastidisce è l'atteggiamento di molte persone che, poichè una cosa non torna, allora deve subito dire: E' STATO DIO!!!
E porcamiseria, siamo seri...pazienza, pazienza e intelligenza e un giorno forse lo scopriremo....e magari non lo scopriremo mai.
Di sicuro sappiamo solo che gli dei sono una gran cavolata.

Dusty
Inviato: 16/8/2007 15:08  Aggiornato: 16/8/2007 15:08
Dubito ormai di tutto
Iscritto: 3/10/2005
Da: Mondo
Inviati: 2248
 Re: Gli anelli mancanti continuano ad aumentare
Un articolo in tema.

Scientists Offer 'Overwhelming' Evidence Terran Life Began in Space

Using data from recent comet-probing space missions, British scientists are reporting today that the odds of life starting on Earth rather than inside a comet are one trillion trillion (10 to the power of 24) to one against. That is, we're not originally from around here. Radiation in comets could keep water in liquid form for millions of years, they say, which along with the clay and organic molecules found on-board would provide an ideal incubator. 'Professor Wickramasinghe said: "The findings of the comet missions, which surprised many, strengthen the argument for panspermia. We now have a mechanism for how it could have happened. All the necessary elements - clay, organic molecules and water - are there. The longer time scale and the greater mass of comets make it overwhelmingly more likely that life began in space than on earth."

"Tu non ruberai, se non avendo la maggioranza dei voti"
-- Dal Vangelo Secondo Keynes, Capitolo 1, verso 1.
Il portico dipinto
olah
Inviato: 16/8/2007 15:42  Aggiornato: 16/8/2007 15:45
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Talmente fantastico, che io a questo “Caso” comincerei a mettere la maiuscola. Così, tanto per evitare sorprese...


In realtà in un sistema deterministico il caso è solo un illusione.

Citazione:
Ma vi rendete conto che il caso è molto più bravo di noi? L’uomo non è assolutamente in grado di creare un altro uomo (dalla materia inerte, intendo), mentre il caso sì.


E' umano essere meravigliati dalla complessità degli esseri viventi. Di fatto però viviamo in un sistema che è complesso in sé e genera complessità a tutti i livelli. Anche un atomo è complicato tanto è vero che siamo ancora lì a cercare di capire come funziona e cosa c'è dentro, eppure se annichiliamo due particelle l'energia si riorganizza spontaneamente a formare nuova materia.

Non è un po' pretenzioso ritenere che solo un'intelligenza speculativa possa arrivare a costruire architetture complesse? Magari è l'inverso, forse è più facile arrivare a certi risultati in un altro modo.

Del resto anche Internet, nel suo insieme e non semplicemente come tecnlogia di rete, forse la più grande opera corale dell'umanità, si è evoluta in modo spontaneo e incontrollato. Ma anche questa è un'altra storia...

olah
Inviato: 16/8/2007 16:08  Aggiornato: 16/8/2007 16:11
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Si leggono spesso interventi del tipo - la teoria evoluzionista non dimostra nulla - senza però dire di quale teoria si sta parlando e dove sbaglia. Nessuna teoria è inconfutabile però per confutarla sarebbe utile seguire alcuni passi fondamentali: primo passo, conoscere la teoria di cui si sta parlando...

Chi invece più semplicemente sostiene che l'idea dell'evoluzione in sé è scientificamente controversa, potrebbe prendersi la briga di citare una quantità di pubblicazioni scientifiche su riviste con un impact factor decente (Science, Nature...) a sostegno di quanto detto. Io non ne ho trovate.

Oldboy
Inviato: 16/8/2007 16:21  Aggiornato: 16/8/2007 17:26
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Ulivinco (gran bel nick, fra l'altro...),

scusa ma hai del tutto frainteso la questione.
Per due motivi:

1) La demolizione del darwinismo è opera di fior di scienziati: biochimici, matematici, astronomi, filosofi della scienza.
Non tutti sono credenti, e non tutti nella stessa religione.
(Ci sono atei, agnostici, cristiani, induisti...)

E' un basso espediente attribuire ai teorici dell'Intelligent Design chissà quale "secondo fine", chissà quale oscuro complotto anti-scientifico.

Le loro obiezioni al darwinismo si basano (tutte) su argomenti rigorosamente scientifici: nessuno di loro parla della Bibbia, o del Corano.

Ovviamente, le loro posizioni si possono e si devono discutere.
Ma come farlo, se sono totalmente escluse dai media e (quasi) totalmente dal dibattito accademico?...

2) Non c'è bisogno di avere letto l'opera omnia di Marx (ma comunque aiuterebbe), per sapere che ogni movimento culturale e scientifico è espressione della sua epoca.

Se l'Intelligent Design può essere accusato di esprimere - surrettiziamente - una certa visione religiosa e filosofica, la stessa accusa si può ben rivolgere al darwinismo.

C'è forse bisogno di ricordare lo stretto legame fra il capitalismo imperialista inglese nell'Ottocento e la visione del mondo espressa da Darwin?
E' stato già fatto, ovviamente, perché è un nesso fin troppo chiaro: "la sopravvivenza del più adatto", la dura "lotta per la vita", le razze superiori e quelle inferiori...

La STRUTTURA economica (ecco di nuovo Marx) dell'epoca aveva un bisogno disperato di un Darwin.
E - naturalmente - lo ebbe.

P.S.
Una piccola, deliziosa citazione per "Ulivinco":

"In qualche tempo avvenire, è quasi certo che le razze incivilte stermineranno e si sostituiranno in tutto il mondo alle razze inferiori.
Nello stesso tempo, anche le scimmie antropomorfe saranno senza dubbio sterminate.

"Allora la lacuna sarà ancor più larga, perché sarà fra un uomo ancor più civile del caucasico e qualche scimmia inferiore, come il babbuino, di quella che esiste ora fra un negro, un aborigeno e un gorilla."
(DARWIN, L'Origine dell'uomo)

Insomma, il tuo caro Darwin riteneva scontato - e necessario - lo sterminio dei popoli neri e dei gorilla, per opera dell'uomo bianco.
Ah, quanto bene ha fatto all'umanità il darwinismo...

Oldboy
Inviato: 16/8/2007 17:05  Aggiornato: 16/8/2007 17:15
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Alcuni mi scrivono:

"Se non credi nell'evoluzionismo, allora spiegaci tu come sono andate le cose."

Questa obiezione è scorretta e - insieme - vagamente insensata.

E' la stessa obiezione che i lettori di Luogocomune si sentono sempre rivolgere a proposito dell'11 settembre:
"Ah, sì? Secondo te il governo USA ha mentito?
E allora sentiamo, sapientone: dicci tu com'è andata..."

Ma se il governo ci racconta una versione ufficiale grottesca e contraddittoria, noi abbiamo il sacrosanto diritto di non crederci:
non dobbiamo guadagnarcelo, questo diritto, scoprendo da soli la verità...
(Nessuno di noi ne avrebbe gli strumenti, fra l'altro.)


Olah, poi, mi sfida a trovare nelle pubblicazioni "autorevoli" (tipo Nature) conferme all'Intelligent Design.

Bella forza, caro Olah: prima si ostracizza ogni critica all'evoluzionismo, e poi si fa passare l'assenza di critiche come prova dell'evoluzionismo stesso!..

Sciascia diceva: "prima lo chiacchierano, e poi dicono che è chiacchierato..."

Così come Olah mi invita a consultare Nature, i sostenitori della versione ufficiale sull'11 settembre ci dicono:

"Ma guarda che l'FBI ha detto che è stato Osama Bin Laden, quindi deve essere così, perché l'FBI è autorevole.
(Non li vedi, i film?... )"

Anonimo
Inviato: 16/8/2007 18:16  Aggiornato: 16/8/2007 18:17
 Re: Gli anelli mancanti continuano ad aumentare
Ma uno che dice solo che un turco sbaglia a basare le sue critiche su calcoli probabilstiici sballati, dove deve andare a scriverlo per farsi leggere?

Spammare da Grillo?

olah
Inviato: 16/8/2007 18:21  Aggiornato: 16/8/2007 18:21
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Olah, poi, mi sfida a trovare nelle pubblicazioni "autorevoli" (tipo Nature) conferme all'Intelligent Design.


Non ti ho mai fatto una richiesta del genere e per favore cerca di non citare anche me a sproposito.

Fabrizio70
Inviato: 16/8/2007 19:23  Aggiornato: 16/8/2007 19:23
Sono certo di non sapere
Iscritto: 18/5/2006
Da: Roma
Inviati: 3721
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:

Questa obiezione è scorretta e - insieme - vagamente insensata.

E' la stessa obiezione che i lettori di Luogocomune si sentono sempre rivolgere a proposito dell'11 settembre:


Già , peccato ce la V.U. sia in questo caso il creazionismo , quindi tu rispondi a chi ti dice che le torri sono state demolite che ciò non é possibile se non ti portano la posizione esatta di ogni carica ed i ritardi degli inneschi.....

Dato che in questa situazione le V.U. sono più d'una ed ognuna pretende di avere ragione quale segui tu ?

Il lusso non può mai essere soddisfatto perché, essendo qualcosa di falso, non esiste per esso un contrario vero e reale in grado di soddisfarlo e assorbirlo.
Wilhelm Richard Wagner-1849
Redazione
Inviato: 16/8/2007 21:37  Aggiornato: 16/8/2007 21:39
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
ULIVINICO. Citazione:
Caro Massimo Mazzucco, non capisco il perché di post con questi toni che sembrano quasi religiosi. Per fortuna capisco che questo non è un sito cattolico ma questo dubitare dell'evoluzione mi sconcerta.
Anche il cattolico, credo, resterebbe sconcertato dal tuo dogmatismo. Permettimi, ma partire dal presupposto di avere ragione, per poi “restare sconcertati “ dalle idee altrui non è proprio da luogocomune.

E un pò come dire, “capisco il diritto alla libertà di pensiero, ma arrivare a credere che il governo americano si sia buttato giù da solo le torri gemelle è qualcosa di allucinante”.

Allora cosa siamo qui a fare, scusa?

°°°

Per quel che riguarda i toni, io li ritengo perfettamente nella norma, anzi ringrazio tutti per una discussione fin qui essenzialmente corretta. D'altronde, la materia è di fondamentale importanza per moltissime persone, ed è comprensibile che ci si appassioni nel difendere le proprie tesi.

Anonimo
Inviato: 17/8/2007 13:13  Aggiornato: 17/8/2007 13:13
 Re: Gli anelli mancanti continuano ad aumentare
Visto che tutti tacciono, vesto io i panni anti-evoluzionisti.

Spero che TUTTI qui dentro siano d'accordo che la teoria creazionista pura, cioé del tizio barbuto che in 6 giorni ha fatto la terra e tutto quello che c'è sopra sia una stronzata a cui manco il Papa può credere.

Esploriamo altri aspetti.

Il tizio barbuto ha creato il seme della vita, da lì tutto si è evoluto secondo la sua natura.
Oppure, ogni tanto il tizio barbuto metteva una mano per dare una sistematina.
Oppure, è onnipresente è dirige in tempo reale tutte le operazioni.
(Non voglio dilungarmi i discussioni teologiche sulle varie opzioni)

Altra possibilità: una razza aliena, stesso meccanismo.

Ha seminato la terra e l'ha lasciata evolvere, o torna ogni tanto per una sistematina, o la controlla in tempo reale.

Perché?

Per un esperimento scientifico, per un mega reality show intergalattico, perché si sentivano soli, perché sono buoni... tanti motivi possono essere.

Spero anche che TUTTI qui dentro concordino che i dinosauri si siano estinti. Ma come sarà mai successo?!?!?

Il barbuto non avrebbe mai sbagliato, né avrebbe permesso ad un meteorite di schiantarsi sulla sua bella Terra nuova nuova, vi pare?

Allora gli alieni: o la ditta appaltatrice ha scazzato qualcosa, hanno fatto un nuovo bando di gara, resettato l'esperiemnto e via con gli ominidi.

Oppure, nel caso del reality, questi rettil sono stati bocciati dal televoto.

Beh, ora mi dite quele versione vi sembra più vicina a ciò che pensate sia accaduto realmente?

Oppure, senza impegno, mi dite la vostra?


Ve l'ho detto, io non so se la vita si sia creata spontaneamente dal nulla, so che non sono in grado di saperlo attualmente.

Ma so anche che l'essere umano ha un gran bisogno di affetto, ed è davvero molto romantico pensare che qualcuno lassù in alto ci voglia bene ed abbia fatto in modo che noi oggi fossimo qui. Piuttosto che rassegnarsi all'idea che siamo soli e che tutto sia solo un mero risultato della legge dei grandi numeri.

E' un po' come sapere che i nostri genitori ci hanno davvero voluto e non essere figli di una sveltina o di un preservativo bucato.

olah
Inviato: 17/8/2007 14:21  Aggiornato: 17/8/2007 14:21
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Il barbuto non avrebbe mai sbagliato, né avrebbe permesso ad un meteorite di schiantarsi sulla sua bella Terra nuova nuova, vi pare?


Esiste la formula del mistero della fede. Della serie: chi siamo noi per interpretare Dio?

Del resto se il barbuto volesse chiarirci le idee, potrebbe sempre iscriversi al forum. Stiamo attenti, magari lo farà... o lo ha gia fatto? Tanto tempo fa ha cercato di partecipare a un forum, ma era un foro romano e lo hanno messo in croce.

Citazione:
Spero che TUTTI qui dentro siano d'accordo che la teoria creazionista pura, cioé del tizio barbuto che in 6 giorni ha fatto la terra e tutto quello che c'è sopra sia una stronzata a cui manco il Papa può credere.


Non so qui dentro, ma ci sono persone che ci credono sul serio. Una volta una signora testimone di Geova mi ha intrattenuto un quarto d'ora parlandomi della creazione e la sua teoria era molto fedele alla narrazione della bibbia. Molto simpatica, a un certo punto mi ha detto che i dinosauri non potevano essere esistiti: "figurati! Quei mostri che divoravano le persone?! Ma va là!". Una persona onesta, ad ogni modo: esprimeva il credo suo e della sua setta senza metterlo in bocca alla comunità scientifica.

nottrz
Inviato: 17/8/2007 14:34  Aggiornato: 17/8/2007 14:34
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
"Se non credi nell'evoluzionismo, allora spiegaci tu come sono andate le cose."

Questa obiezione è scorretta e - insieme - vagamente insensata.


Nel mio caso non si trattava di una obiezione, ma di semplice curiosita'.


Citazione:
prima si ostracizza ogni critica all'evoluzionismo, e poi si fa passare l'assenza di critiche come prova dell'evoluzionismo stesso!..


Condivido. Spesso le teorie minori, soprattutto quelle molto alternative, vengono escluse dai dibattiti ufficiali. Quindi il fatto che la redazione di qualche grossa rivista rimbalzi i loro articoli non puo' essere usato come argomento.
E' un vantaggio dei "complottisti", che possono usare l'assenza di prove a loro vantaggio (in alcuni casi legittimamente in altri no).

In molti casi pero', lasciando da parte questo, le teorie vengono rimbalzate da un paio di articoli "privati" evidenziandone alcuni gravi difetti (es. inapplicabilita' dei principi usati, violazione della conservazione dell'energia o simili dettagli). A quel punto il ricercatore alternativo fa finta di non aver recepito la critica (o la trasforma in una tesi a favore del proprio lavoro) e accusa "il sistema" di non volerlo pubblicare per giochi di potere e simili.
Dall'altro lato di casi di scienziati il cui lavoro sia stato ignorato/contestato e solo molti anni dopo riconosciuto come validissimo ne conosciamo fin troppi.

E' anche vero che una rivista fa bene a non pubblicare articoli che non passino neppure un minimo di revisione che, in teoria, dovrebbe consistere esclusivamente in una valutazione della correttezza formale dell'articolo senza entrare nel merito dei contenuti.

Infine l'intelligent design/creazionismo non e' esattamente una teoria minore, ma e' stato il verbo per qualche migliaio di anni e il suo ruolo nella nostra societa' continua a essere importante (vedi insegnamento nella scuole).
Se si cercano su amazon libri su questi argomenti se ne troveranno moltissimi sia a favore che contro. Questo significa che c'e' un dibattito su questo tema.

nottrz
Inviato: 17/8/2007 15:12  Aggiornato: 17/8/2007 15:12
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:

I miti piu' antichi non dicono forse che tutto si e' formato dalla musica?

Me ne segnali qualcuno?


sitchinite, li ho cercati un bel po' ma non li ho trovati.

Ricordavo qualcosa nel...ehm...silmarillion :) che pensavo fosse ispirato a qualche mito nordico.
Poi ricordavo qualcosa nella cosmogonia ebraica e nelle upanishad ma su google non ho trovato nulla :|

Qui ne trovi un bel po', ma praticamente nessuno parla di musica o canti.

http://it.wikipedia.org/wiki/Cosmogonia

O me li sono sognati o bisogna cercarli meglio.


Citazione:

Spero che TUTTI qui dentro siano d'accordo che la teoria creazionista pura, cioé del tizio barbuto che in 6 giorni ha fatto la terra e tutto quello che c'è sopra sia una stronzata a cui manco il Papa può credere.


Non ci giurerei. Fino a 1 mese fa su you tube c'era un pezzo di una puntata di south park in cui si raccontava che cosa credono quelli di scientology. Era bellissimo.
Purtoppo adesso il video e' misteriosamente scomparso...

Questo blog riassume un po' le idee principali:

"75 milioni di anni fa Xenu, un cattivissimo tiranno galattico abbia imprigionato miliardi di anime di alieni , le abbia buttate in un vulcano e di come queste anime aliene dette Thetan si siano "inzeccate" nei corpi umani provocando malanni fisici e spirituali."

Non so quanto south park ci abbia ricamato sopra, ma...

olah
Inviato: 17/8/2007 15:33  Aggiornato: 17/8/2007 16:19
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Condivido. Spesso le teorie minori, soprattutto quelle molto alternative, vengono escluse dai dibattiti ufficiali. Quindi il fatto che la redazione di qualche grossa rivista rimbalzi i loro articoli non puo' essere usato come argomento.
E' un vantaggio dei "complottisti", che possono usare l'assenza di prove a loro vantaggio (in alcuni casi legittimamente in altri no).


Può succedere che una rivista si rifiuti di pubblicare un articolo fuori dal coro, ma se quell'articolo è valido si dà una zappata sui piedi perché perde una montagna di referenze (da cui dipende l'impact factor), a tutto vantaggio di una rivista concorrente.

Di fatto la comunità scientifica è un insieme di persone che condivide i risultati del proprio lavoro pubblicandoli nelle riviste specialistiche. Il peso di queste riviste dipende dalla credibilità di cui godono presso la comunità che le sostengono sostiene, credibilità che a sua volta dipende dalla qualità degli articoli che, per essere pubblicati, devono rispettare in modo rigoroso una serie di regole. Questo non impedisce a una rivista di pubblicare qualche fesseria di tanto in tanto, o di negare la pubblicazione di un articolo valido (pubblicabile comunque su riviste concorrenti), ma nel complesso il sistema ha consentito agli scienziati di condividere le informazioni in modo serio e nel rispetto di regole comuni.

Mi scuso se dico delle banalità, ma non tutti sono del mestiere.
Il valore di una rivista scientifica non è determinato semplicemente dal numero di copie venduto ma il suo peso dipende anche da un valore che si chiama impact factor, un numero che indica la frequenza con cui un articolo "medio" è citato dai colleghi in un deternimato periodo. Chiaramente gli scienziati cercano di pubblicare nelle riviste con IF più alto (non solo per una questione di prestigio, ma anche per questioni di carriera, finanziamenti...), quindi se una rivista vuole gli articoli migliori deve avere un IF alto e se boccia un articolo particolarmente valido si fa del male.

Naturalmente questo sistema non è esente da una serie di problemi, come ad esempio le pressioni degli sponsor, un trattamento di riguardo per certi nomi a dispetto di altri ecc., ma nell'insieme ha permesso lo sviluppo di un'attività scientifica che altrimenti sarebbe stata piuttosto difficile se non impossibile.

In conclusione, dire che un'idea è fortemente controversa dalla comunità scientifica ma non nelle riviste autorevoli mi sembra un controsenso, dato che le riviste autorevoli dipendono dalla comunità scientifica.

Se poi si parte con la solita solfa della scienza ufficiale e non ufficiale, allora siamo tutti grandi scienziati e finisce lì.

Redazione
Inviato: 17/8/2007 18:41  Aggiornato: 17/8/2007 18:41
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
Perdonami Morfeo. ma come “anti-evoluzononista” sei rimandato a ottobre. Nessuna persona seria userebbe mai l’esempio del “tizio barbuto”, per scartare l’ipotesi divina.

Mentre temo che il prof. di Logica ti farebbe addirittura ripetere l’anno. Con il tuo tentativo di attraversare la barriìcata, hai commesso due fallacie in un colpo solo: uomo di paglia, e falso dilemma. Un pò come fare fallo di mano in area mentre stai falciando l’attaccante avversario.

(Guarda un pò che esempio avevo usato, quando scrissi la pagina sulle fallacie logiche):

Falso dilemma. Un esempio classico è quello dell'interminabile dibattito fra creazionismo ed evoluzionismo, dove la fallacia viene curiosamente adottata da ambo le parti senza ormai più nessun ritegno.

Da una parte si dice: "L'evoluzionismo non dà conto del passaggio dalla scimmia all'uomo (anello mancante), quindi ha ragione il creazionismo". Dall'altra si risponde: "Siccome il mondo non può avere seimila anni, come vorrebbe la Bibbia, è l'evoluzionismo la teoria giusta".

Questa fallacia presuppone che non vi siano alternative alle due tesi concorrenti, quando in realtà non è possibile affermarlo. Ben diverso sarebbe sostenere che un uomo "è morto, poichè non è più vivo", o viceversa, quando le alternative siano effettivamente solo due.

La fallacia del falso dilemma è molto più diffusa di quello che si creda, perchè si nasconde spesso in proposizioni che a prima vista suonano perfettamente coerenti. Consideriamo le risposte a queste due affermazioni:

A - Credo che il capitalismo abbia assunto nella nostra società una forma disumana”
R - “E allora cosa dovremmo dire dei morti fatti dal comunismo?”

A - “La democrazia moderna ha fallito il suo compito”
R - “Ma sì, torniamo pure alle dittature che torturano la povera gente”

Ambedue le risposte presuppongono che vi siano solo due alternative al problema, il che in ciascun caso non è assolutamente vero.


Il problema dell’evoluzionista (del materialista) è che manca assolutamente di fanstasia. Che è poi la debolezza del ragionamento deduttivo: o la risposta è già compresa nella premessa, altrimenti non la si potrà mai trovare.

Anonimo
Inviato: 17/8/2007 19:24  Aggiornato: 17/8/2007 19:24
 Re: Gli anelli mancanti continuano ad aumentare
Mio caro Nottrz basta chiedere:

South park e scientology


:)

Anonimo
Inviato: 17/8/2007 19:33  Aggiornato: 17/8/2007 19:33
 Re: Gli anelli mancanti continuano ad aumentare
Sì Massimo, ma io l'ho scritto solo per "provocare". Ho buttato delle ipotesi e vi ho chiesto secondo voi quale potrebbe avvicinarsi a quello che voi credete sia successo. Non volevo scartarne nessuna scrivendo quello che ho scritto.

Tu hai pensato a debunkarmi ma non mi hai risposto.

Mi dici tu come credi sia andata la cosa?

Non ti chiedo nessuna dimostrazione, ma solo per curiosità, per te cosa è successo?

Naturalmente lo stesso invito è aperto a tutti gli altri.

Redazione
Inviato: 17/8/2007 20:01  Aggiornato: 17/8/2007 20:10
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
MORFEO:Per te cosa è successo?

L'ho già scritto, ma lo riposto volentieri:

Le prime molecole erano lì perchè erano lì, secondo il noto principio antropico (se non c'erano tu non lo sapevi, ma siccome lo sai allora c'erano). Creare la prima proteina, imbroccando la precisa sequenza di 238 aminoacidi tutti in quell'ordine fu, è stato ammesso, un certo colpo di fortuna, ma da lì a dare origine alle prime forme di vita monocelluari, in compenso fu un attimo. E' noto infatti che in quelle condizioni - lampi tuoni e magma dappertutto - basta che una caseina passi accanto ad una rodopsina, ed è subito ameba.

Per passare alla riproduzione sessuata poi, bastò uno sguardo allo specchio dell'ameba, che si piacque, e decise di invitarsi a cena quella sera. Il DNA nacque per caso, una domenica pomeriggio, nello scontro fra due pullman di basi nucleotidiche che tornavano dalla gita nostalgica allo stagno primordiale. Le adenine andarono tutte a incocciare con le timine, e le guanine con le citosine. I poveri cadaverini erano talmente ingrovigliati l'uno con l'altro, che gli ispettori della RNA (Road National Assistence) rinunciarono a separarli. Fotografarono il tutto in doppia copia, e lo mandarono alla Centrale.

Da quel giorno, col DNA che teneva l'evoluzione sotto controllo, le cose presero a funzionare a giusto ritmo. In fondo, mancavano solo trecento milioni di anni per arrivare a Bush, e non c'era altro tempo da perdere con tentativi fatti a casaccio.

Per un pò tutto procedette bene, con le mutazioni casuali che ogni volta davano esattamente quello di cui c'era bisogno per evolversi, ma dopo un pò, temendo comunque di non farcela, il DNA tentò una tirata multipla di dadi, che per fortuna andò per il meglio: in un colpo solo uscirono venti tipi di alghe diverse, un cavalluccio marino, tre squali, sedici sardine, un pesce-martello, e uno splendido puma tibetano. Alla domanda dello squalo, che gli chiedeva "ma tu chi saresti, scusa?", il puma rispondeva altezzoso "non mi rompere i coglioni, non lo vedi che sono un salto quantico?"

La voce si sparse rapida sulla terra, e da quel momento l'accelerazione fu irreversibile. Tutti a giocarsi la sopravvivenza della specie con mutazioni genetiche da brivido. Coccodrilli che rischiavano il tutto per tutto per diventare ippopotami (vuoi mettere, nell'acqua, il vantaggio della visione dall'alto?), tozzi asini e muli che si facevano mettere il cibo sui ripiani più alti, per allungarsi il collo e diventare delle splendide giraffe. Scoiattoli stufi di prendere delle gran facciate in terra, ogni volta che si lanciavano da un ramo all'altro, che sviluppavano nuovi tessuti sotto le ascelle e diventavano pipistrelli.

Quando poi il pesce-martello divenne una rana, la transizione fu talmente rapida che non se ne accorse nessuno, e tempo che anche gli altri si sbrigarono a uscire dall'acqua (in certi casi le mutazioni puoi invocarle tu direttamente, anche trecento alla volta, basta compilare apposito modulo), e quello era già diventato una dinosauro. Minchia, disse la sardina, che nel frattempo si era ritrovata a fare l'aquila imperiale, ma come si evolve in fretta, quello lì! Il dinosauro, tutto gasato dalla popolarità, tentò a quel punto un salto quantico mai provato prima, e volle diventare direttamente un ragioniere dell'IBM: restò però imbrigliato a metà strada, e divenne un misero Africanus Affarensis, mentre la sua specie, per lo spavento, si estingueva di colpo (alcuni furono trovati con il cibo nello stomaco ancora da digerire). Dall'Affarensis a Leonardo da Vinci fu comunque un attimo, ed ecco spiegata l'evoluzione delle specie.

Infine, quando andiamo al mare, e osserviamo la splendida distesa dì sabbia lucente, rivolgiamo un pensiero commosso a tutti quelli che non ce l'hanno fatta: quei granelli di sabbia in realtà non sono sabbia, sono i cadaverini piccoli piccoli piccoli di tutti quegli esseri che la legge del più forte non ha ritenuto nemmeno di far crescere abbastanza per vedere se ce la facevano davvero. Fu così appunto che nacque la famosa canzoncina, "Era meglio morire da piccoli..."

°°°

(Ora cerco anche di darti una risposta seria).

Anonimo
Inviato: 17/8/2007 20:06  Aggiornato: 17/8/2007 20:06
 Re: Gli anelli mancanti continuano ad aumentare
Sì, è simpatica come cosa, ma perché non rispondi?

Redazione
Inviato: 17/8/2007 20:11  Aggiornato: 17/8/2007 20:11
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
Sto scrivendo. Quello era un articolo già fatto.

Redazione
Inviato: 17/8/2007 20:17  Aggiornato: 17/8/2007 20:28
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
Secondo me, come principio generale, è la mente che crea la materia, e non viceversa.

A livello divino, hai la creazione del Cosmo. A livello antropico, hai la creazione dell'Uomo (non da parte di "Dio", ma di entità intermedie, rappresentate allegoricamente dagli Arcangeli nella tradizione giudeocristiana, dai Cohan in quelle orientali).

Il Cosmo è una entità intelligente e autoregolantesi, esattamente come nel micro lo è l’organismo vivente, tramite il DNA. La struttura del Cosmo è in qualche modo frattale, e a sua volta l’Uomo è una perfetta replica del sistema/magnitudine superiore.

Il tutto è un grande "film" (il “Dreamtime” degli aborigeni australiani), proietatto su un "telone" - il mondo fisico (la caduta nella materia della Bibbia) - di cui noi riusciamo a perceopire solo tre dimensioni, ma che ne ha certamente molte di più. Visto da fuori, è un film. Visto da dentro è un incubo.

Ora però non mi fare domande: hai detto che non volevi dimostrazioni, ma solo intuizioni.

nessuno
Inviato: 17/8/2007 23:22  Aggiornato: 17/8/2007 23:22
Mi sento vacillare
Iscritto: 30/7/2005
Da: Albino (BG) - Bassa Valle Seriana
Inviati: 501
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Secondo me, come principio generale, è la mente che crea la materia, e non viceversa.


Un'idea, un concetto, un'idea,
finché resta un' idea, è soltanto un'astrazione,
se potessi mangiare un'idea
avrei fatto la mia rivoluzione.

(G. Gaber)

Buona vita

Guglielmo

"Quieremos organizar lo entusiasmo, no la obediencia" - Buenaventura Durruti
Kirbmarc
Inviato: 18/8/2007 0:46  Aggiornato: 18/8/2007 0:46
Dubito ormai di tutto
Iscritto: 17/5/2006
Da: Arkadia-spazio profondo
Inviati: 1665
 Re: Gli anelli mancanti continuano ad aumentare
Visto che si continua a parlare a vanvera di caso e causalità, ecco una lettura chiarificante ed estremamente semplice.

"Abbiamo visto che le cose viventi sono troppo improbabili e troppo meravigliosamente "congegnate" per essere nate per caso. Allora, come sono nate? La risposta, scoperta da Darwin, è che sono nate per mezzo di trasformazioni graduali, passo-passo, a partire da entità primitive abbastanza semplici da poter nascere per caso. In questa serie graduale di cambiamenti successivi, ogni singolo cambiamento è stato abbastanza semplice, rispetto al suo predecessore, da poter nascere per caso. Ma la sequenza intera di questi passi cumulativi costituisce un processo tutt'altro che casuale [..]. Infatti il processo cumulativo è guidato dalla sopravvivenza non casuale. Lo scopo di questo capitolo è illustrare il potere di questa selezione cumulativa come processo non casuale.

Se cammini su e giù per una spiaggia di ciottoli, noterai che i ciottoli non sono disposti in modo casuale. I ciottoli più piccoli tendono a trovarsi in zone circoscritte che corrono per la lunghezza della spiaggia, mentre quelli più grandi si troveranno in zone, o strisce, diverse. Questi ciottoli sono stati ordinati, arrangiati, selezionati. Una tribù che vivesse vicino alla spiaggia potrebbe meravigliarsi di fronte a questa evidenza di ordine del mondo, e potrebbe sviluppare una mitologia per darne conto, magari attribuendo quell'ordine ad un grande spirito nel cielo dotato di una mente ordinata e un senso di rigore. Potremmo sorridere con superiorità di fronte a una simile superstizione, e dir loro che quella disposizione è stata prodotta in realtà dalle cieche forze della fisica, in questo caso dall'azione delle onde. Le onde non hanno nessuno scopo o intenzione, nessuna mente ordinata, anzi nessuna mente e basta. Esse semplicemente rimescolano i ciottoli con forza, e i ciottoli grandi e i ciottoli piccoli rispondono in modo diverso a questo trattamento, così che terminano in posti diversi della spiaggia. Una piccola quantità di ordine è sorta spontaneamente dal disordine, e nessuna mente l'ha pianificata.

Le onde e i sassolini, messi insieme, costituiscono un esempio semplice di sistema che genera automaticamente non-casualità. Il mondo è pieno di sistemi di questo genere. L'esempio più semplice che mi viene in mente è un buco. Solo gli oggetti più piccoli del buco possono passare attraverso di esso. Questo significa che se si parte da un insieme casuale di oggetti sopra al buco, e qualche forza li scuote in modo casuale, dopo un po' gli oggetti sopra il buco e quelli sotto si troveranno ad essere ordinati in modo non casuale. Lo spazio sotto il buco tenderà a contenere oggetti più piccoli del buco, e lo spazio sopra tenderà a contenere oggetti più grandi del buco. L'umanità, naturalmente, ha imparato da tempo a sfruttare questo semplice principio per generare non casualità, con il dispositivo noto come setaccio.

Il sistema solare è un'organizzazione stabile di pianeti, comete e detriti in orbita intorno al sole, ed è presumibilmente solo uno di molti sistemi simili orbitanti nell'universo. Più vicino al sole un satellite si trova, più velocemente esso deve viaggiare per poter contrastare la gravità del sole e rimanere in un'orbita stabile. Per ogni data orbita, c'è soltanto una velocità a cui un satellite può viaggiare e rimanere in quell'orbita. Se stesse viaggiando a qualunque altra velocità, fuggirebbe via nello spazio profondo, oppure precipiterebbe nel sole, oppure si sposterebbe in un'altra orbita. Se guardiamo i pianeti del nostro sistema solare scopriamo che -- guardacaso -- ognuno di loro sta viaggiando esattamente alla giusta velocità per mantenersi in orbita stabile intorno al sole. Si tratta forse di un miracolo o di un disegno provvidenziale? No, è solo un altro "setaccio" naturale. Ovviamente tutti i pianeti che vediamo in orbita intorno al sole devono viaggiare esattamente alla velocità giusta per restare in orbita, altrimenti non li vedremmo, perché non ci sarebbero! Ma è altrettanto ovvio che questa non è evidenza di un disegno consapevole. È solo un altro tipo di setaccio.

Un setaccio di quest'ordine di semplicità non è, da solo, sufficiente a spiegare l'enorme quantità di ordine non casuale che vediamo nelle cose viventi. Non è neppure lontanamente sufficiente. Ricordate l'analogia del lucchetto a combinazione. Il tipo di non-casualità che si può generare con un semplice setaccio è più o meno equivalente ad aprire un lucchetto a combinazione al primo colpo: è facile che avvenga per semplice fortuna. Ma il tipo di non casualità che vediamo nei sistemi viventi è equivalente a un enorme lucchetto a combinazione con un numero di cifre spaventosamente grande, quasi incontabile. Generare una molecola biologica come l'emoglobina, il pigmento rosso del sangue, con un semplice setaccio equivarrebbe a prendere tutti gli aminoacidi costitutivi dell'emoglobina, shakerarli a caso, e sperare che la molecola di emoglobina si ricostituisca per un semplice colpo di fortuna. La quantità di fortuna che sarebbe necessaria per quest'impresa è inconcepibile, ed è stata utilizzata come termine di paragone da Isaac Asimov ed altri.

Una molecola di emoglobina consiste di quattro catene di aminoacidi attorcigliate insieme. Concentriamoci soltanto su una di queste quattro catene. Consiste di 146 aminoacidi. Ci sono 20 differenti tipi di aminoacidi che si trovano comunemente nelle cose viventi. Il numero di modi possibili di disporre 20 tipi di oggetti in catene di lunghezza 146 è un numero inconcepibilmente grande, che Asimov chiamò "il numero dell'emoglobina". È facile da calcolare, ma è impossibile visualizzare la risposta. Il primo anello nella catena di 146 potrebbe essere uno qualunque dei 20 possibili aminoacidi. Il secondo anello potrebbe anche esso essere uno tra 20, così il numero di possibili catene di lunghezza due è 20 x 20, cioè 400. Il numero possibile di catene di lunghezza 3 è 20 x 20 x 20, cioè 8000. Il numero di catene possibili di lunghezza 146 è 20 moltiplicato per se stesso 146 volte. Si tratta di un numero enorme. Un milione è 1 con sei zeri dopo di esso. Un miliardo è un 1 con nove zeri dopo di esso. Il numero che cerchiamo, il numero dell'emoglobina, è circa 1 con 190 zeri dopo di esso. Quindi la probabilità di produrre emoglobina per un semplice colpo di fortuna è 1 su quel numero enorme [quindi è una probabilità piccolissima, NdM]. E una molecola di emoglobina ha solo una piccola frazione della complessità di un corpo vivente. Un semplice setaccio, da solo, non è lontanamente capace di generare la quantità di ordine che si trova in una cosa vivente. Il setacciare è un ingrediente essenziale per generare l'ordine vivente, ma è ben lontano da essere la conclusione della storia. Serve anche qualcos'altro. Per illustrare il punto, dovrà fare una distinzione tra selezione "a passo singolo" e selezione "cumulativa". I setacci semplici che abbiamo considerato fino ad ora in questo capitolo sono tutti esempi di selezione a passo singolo. L'organizzazione vivente è il prodotto della selezione cumulativa.

La differenza fondamentale tra la selezione a passo singolo e la selezione cumulativa è questa: nella selezione a passo singolo le entità che vengono selezionate o ordinate (sassolini o qualunque altra cosa) vengono ordinate una volta per tutte. Nella selezione cumulativa, invece, si "riproducono"; o comunque il prodotto del processo di setacciamento viene in qualche modo dato "in pasto" a una seconda operazione di setacciamento, il cui prodotto viene a sua volta dato in pasto ad una terza, e così via. Le entità vengono sottoposte a selezione o ordinamento per molte "generazioni" successive. Il prodotto finale di ogni generazione di selezione è il punto di partenza per la prossima, e così via per molte generazioni. È naturale che io prenda in prestito parole come "riprodursi" e "generare", che di solito associamo alle cose viventi, perché le cose viventi sono per noi l'esempio principale di cose soggette a selezione cumulativa. [...]

A volte le nuvole, a causa del vento che le spinge e le rimescola in modo casuale, assumono le sembianze di oggetti familiari. C'è una fotografia molto nota, scattata da un pilota di un piccolo aeroplano, che raffigura ciò che sembra un po' il volto di Gesù che spunta fuori dal cielo. Tutti noi abbiamo visto nuvole che ci ricordavano qualcosa -- un cavalluccio marino, ad esempio, o un volto sorridente. Queste somiglianze nascono mediante selezione a passo singolo, cioè in altre parole per una singola coincidenza. Di conseguenza, non sono molto impressionanti. La somiglianza dei segni zodiacali con gli animali di cui portano il nome (scorpione, leone e così via) non è impressionante, come non lo sono le predizioni degli astrologi. Noi non ci sentiamo sconcertati da quella somiglianza, quanto invece siamo sconcertati dalla complessità degli oggetti biologici -- che sono il prodotto della selezione cumulativa. Ad esempio ci appare spettacolare la somiglianza di un insetto foglia ad una foglia, o di una mantide religiosa ad un gruppo di fiori rosa; ma la somiglianza di una nuvola ad una donnola è solo un po' curiosa, e a malapena ci prendiamo la briga di portarla all'attenzione di un amico. Inoltre, tendiamo a cambiare opinione sull'oggetto a cui la nuvola davvero assomiglia.



Amleto. Vedete laggiù quella nuvola che sembra un cammello?

Polonio. Sacripante! E' un cammello davvero!

Amleto. O forse somiglia a una donnola.

Polonio. Infatti, è proprio una donnola.

Amleto. Non pare una balena?

Polonio. Tale e quale a una balena.


Non so chi sia stato il primo a dire che, dato un tempo abbastanza lungo, una scimmia che battesse a caso sui tasti di una macchina per scrivere potrebbe produrre tutte le opere di Shakespeare. La frase cruciale è, ovviamente, "dato un tempo abbastanza lungo". Supponiamo che la scimmia debba produrre non le opere complete di Shakespeare, bensì solo la breve frase "o forse somiglia a una donnola" [METHINKS IT IS LIKE A WEASEL], e noi le faciliteremo il compito dandole una macchina per scrivere con una tastiera ridotta, con le sole 26 lettere (maiuscole) e la barra per gli spazi. Quanto tempo impiegherà la nostra scimmia dattilografa a scrivere quest'unica piccola frase?

La frase comprende 28 caratteri, cosicché supporremo che la scimmia compia una serie di 'tentativi' discreti di 28 battute. Se la scimmia scriverà la frase correttamente, l'esperimento sarà concluso. In caso contrario le permetteremo un altro 'tentativo' di 28 battute. Ora io non conosco scimmie, ma per fortuna mia figlia, che ha 11 mesi, è un ottimo dispositivo generatore di casualità, ed ha accettato con entusiasmo il ruolo di scimmia dattilografa. Ecco cosa ha digitato al computer:

UMMK JK CDZZ F ZD DSDSKSM

S SS FMCV PU I DDRGLKDXRRDO

RDTE QDWFDVIOY UDSKZWDCCVYT

H CHVY NMGNBAYTDFCCVD D

RCDFYYYRM N DFSKD LD K WDWK

HKAUIZMZI UXDKIDISFUMDKUDXI

Mia figlia ha anche altri impegni importanti, per cui sono stato costretto a programmare il computer per simulare l'opera di un bambino piccolo o una scimmia che battessero a caso sulla tastiera:

WDLDMNLT DTJBKWIRZREZLMQCO P

Y YVMQKZPGJXWVHGLAWFVCHQYOPY

MWR SWTNUXMLCDLEUBXTQHNZVIQF

FU OVAODVYKDGXDEKYVMOGGS VT

HZQZDSFZIHIVPHZPETPWVOVPMZGF

GEWRGZRPBCTPGQMCKHFDBGW ZCCF

E così via. Non è difficile calcolare quanto tempo dovremo ragionevolmente attendere perché il computer (o il bambino piccolo o la scimmia) con questo sistema casuale produca la frase METHINKS IT IS LIKE A WEASEL. Si pensi al numero totale dei frasi possibili della lunghezza corretta che la scimmia o il bambino o il computer potrebbero digitare. È lo stesso tipo di calcolo che abbiamo fatto per l'emoglobina, e produce un risultato similmente grande. Nella prima posizione ci sono 27 lettere possibili (considerando anche lo spazio come una lettera). Quindi la probabilità che la scimmia azzecchi subito la prima lettera, la M, è una su 27. La probabilità di azzeccare le prime due lettere - ME - è uguale alla probabilità di azzeccare la prima lettera, moltiplicata per la probabilità di azzeccare la seconda lettera (la E), sapendo che la prima lettera è stata già azzeccata. [E quest'ultima probabillità è sempre 1/27, perché il fatto di aver azzeccato la prima lettera non rende più facile azzeccare la seconda, né più difficile. Infatti stiamo generando lettere completamente a caso, senza tener conto delle lettere precedenti. NdM] Abbiamo perciò (1/27) x (1/27), che fa 1/729. La probabilità che la scimmia azzecchi la prima parola (METHINKS) è 1/27 per ciascuna delle otto lettere, cioè (1/27) x (1/27) x (1/27) .... x (1/27) eccetera, otto volte, cioè 1/27 all'ottava potenza. La probabilità che azzecchi l'intera frase di 28 lettere è 1/27 alla ventottesima potenza, cioè 1/27 moltiplicato per se stesso 28 volte. Questa è una probabilità molto piccola, circa uno su 10.000 milioni di milioni di milioni di milioni di milioni di milioni. Servirebbe molto tempo per ottenere la frase che cerchiamo, per non parlare di battere a macchina le opere complete di Shakespeare.

Quanto detto vale però quando selezioniamo variazioni casuali con un singolo passo. Che dire della selezione cumulativa? Quanto è più efficace questo genere di selezione? La risposta è: molto, molto più efficace, forse più di quanto possiamo renderci conto a prima vista, anche se, a rifletterci sopra un po' di più, si vede che è una cosa quasi ovvia. Usiamo di nuovo la nostra scimmia computerizzata, ma con una differenza determinante nel suo programma. La scimmia comincia anche qui scegliendo una sequenza casuale di 28 lettere, esattamente come nel primo esperimento:


WDLMNLT DTJBKWIRZREZLMQCO P

Ma stavolta la scimmia "fa riprodurre" questa frase casuale. Ne fa tante copie, ma con una certa probabilità di errore casuale -- mutazione -- nell'operazione di copiatura. Poi, il computer esamina le varie frasi mutanti (i 'figli' della frase originale) e sceglie quella che somiglia di più, anche di pochissimo, alla frase che costituisce il nostro obiettivo, METHINKS IT IS LIKE A WEASEL. Il caso ha voluto che la frase scelta per la prossima 'generazione' fosse:

WDLTMNLT DTJBSWIRZREZLMQCO P

Non è un miglioramento così evidente! Ma la procedura viene ripetuta: di nuovo dei 'figli' mutanti vengono 'fatti nascere' dalla frase, e viene scelto un nuovo 'vincitore'. Questo prosegue generazione dopo generazione. Dopo 10 generazioni, la frase scelta per 'riprodursi' era:

MDLDMNLS ITJISWHRZREZ MECS P

Dopo 20 generazioni era:

MELDINLS IT ISWPRKE Z WECSEL

A questo punto, con un po' di buona volontà possiamo vedere una somiglianza alla frase che è il nostro obiettivo. Alla generazione 30 non può esserci dubbio:

METHINGS IT ISWLIKE B WECSEL

La generazione 40 ci porta ad una sola lettera dall'obiettivo:

METHINKS IT IS LIKE I WEASEL

E l'obiettivo fu finalmente raggiunto alla generazione 43. Una seconda esecuzione del programma al computer cominciò casualmente con la frase:

Y YVMQKZPFfXWVHGLAWFVCHQXYOPY

E passò attraverso (di nuovo sto riportando solo una rigenerazione ogni 10):

Y YVMQKSPFTXWSHLIKEFV HQYSPY
YETHINKSPITXISHLIKEFA WQYSEY
METHINKS IT ISSLIKE A WEFSEY
METHINKS IT ISBLIKE A WEASES
METHINKS IT ISJLIKE A WEASEO
METHINKS IT IS LIKE A WEASEP

E raggiunse la frase obiettivo alla generazione 64. Una terza esecuzione del programma cominciò casualmente con

GEWRGZRPBCTPGQMCKHFDBGW ZCCF

E raggiunse METHINKS IT IS LIKE A WEASEL in 41 generazioni di riproduzione selettiva.

Non importa il tempo esatto impiegato la computer per raggiungere l'obiettivo. [L'operazione richiese qualche minuto.] Ciò che conta è la differenza tra il tempo impiegato dalla selezione cumulativa, e il tempo che lo stesso computer impiegherebbe per raggiungere l'obiettivo se fosse costretto a usare la selezione a passo singolo: circa un milione di milioni di milioni di milioni di milioni di anni. E questo è un milione di milioni di milioni di volte più dell'età dell'universo. In realtà sarebbe più giusto dire che, in confronto al tempo necessario perché una scimmia o un computer programmato a caso digiti la nostra frase obiettivo, l'età complessiva dell'universo è una quantità piccolissima e trascurabile [..]. Invece il tempo impiegato dal computer funzionando sempre a caso ma con il vincolo di operare una selezione cumulativa è una quantità del tutto comprensibile per gli esseri umani, cioè tra 11 secondi e il tempo necessario per pranzare.

Quindi c'è una grande differenza tra la selezione cumulativa (in cui ogni miglioramento, per quanto minuscolo, viene usato come base per la selezione futura), e la selezione a passo singolo (in cui ogni tentativo ricomincia da zero). Se il progresso evolutivo avesse dovuto affidarsi alla selezione a passo singolo, non sarebbe arrivato da nessuna parte. Se tuttavia le condizioni necessarie per la selezione cumulativa vengono prodotte dalle cieche forze della natura, le conseguenze sono strane e meravigliose. Si dà il caso che proprio questo sia successo su questo pianeta, e noi stessi siamo la più recente, se non la più strana e meravigliosa, di queste conseguenze.

È sorprendente che ancora oggi dei calcoli come quello dell'emoglobina vengano usati come se fossero argomenti contro la teoria di Darwin. Le persone che fanno questo, spesso esperte in campi come l'astronomia o altro, sembrano credere sinceramente che il darwinismo spieghi l'organizzazione vivente in termini del puro caso -- cioè selezione a passo singolo. Questa credenza che l'evoluzione darwiniana sia 'casuale' non è soltanto falsa. È l'esatto opposto della verità. Il caso è un ingrediente secondario nella ricetta darwiniana. L'ingrediente più importante è la selezione cumulativa che è crucialmente non casuale. Le nuvole non sono capaci di innescare una selezione cumulativa. Non c'è alcun meccanismo per cui le nuvole di una certa forma possono produrre delle nuvole figlie somiglianti al genitore. Se esistesse un tale meccanismo, se una nuvola che assomiglia a una donnola o a un cammello potesse dar luce a una discendenza di altre nuvole più o meno della stessa forma, la selezione cumulativa avrebbe l'opportunità di prendere il via. Naturalmente di tanto in tanto le nuvole si dividono e formano nuvole 'figlie', ma questo non basta per la selezione cumulativa. È anche necessario che i figli di ogni data nuvola assomiglino al 'genitore' più di quanto somigliano a ogni altra nuvola nella 'popolazione'. Questo punto di importanza fondamentale è apparentemente frainteso da alcuni dei filosofi che, negli anni recenti, si sono interessati alla teoria della selezione naturale. Inoltre la probabilità che una nuvola sopravviva e produca copie di se stessa deve dipendere dalla sua forma. Forse in qualche distante galassia queste condizioni si sono verificate, ed il risultato, se sono passati abbastanza milioni di anni, è qualche forma di vita sfuggente ed eterea."

Oldboy
Inviato: 18/8/2007 1:52  Aggiornato: 18/8/2007 2:09
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Kirbmarc,

mi spiace ma la tua "lettura" non è affatto chiarificatrice come tu sembri pensare, e inoltre contiene fin troppe imprecisioni e petizioni di principio.

Vista l'ora tarda, te ne faccio notare solo due:

1) L'autore sembra dare per scontata la vecchia versione dell'evoluzionismo ("trasformazioni graduali, passo passo"), come fosse una verità incontrovertibile.

In realtà, questa versione è ormai vista come superata dagli stessi evoluzionisti, da quando Eldredge e Gould hanno proposto la loro teoria degli "equilibri punteggiati".
(Non più mutamento graduale e quasi impercettibile, ma improvviso e catastrofico.)

Anche questa nuova teoria è priva di qualsiasi riscontro probatorio, così come quella precedente.

Ma sembra avere il vantaggio di spiegare la desolante mancanza dei famosi anelli di congiunzione (che lo stesso Darwin riteneva dovessero essere innumerevoli).

E' evidente il nesso:

Darwin liberale moderato - teoria dei mutamenti graduali e "passo passo"

Gould marxista - teoria del mutamento improvviso, catastrofico e "rivoluzionario"...

Oldboy
Inviato: 18/8/2007 2:08  Aggiornato: 18/8/2007 2:23
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
2) Il fatto che i ciottoli di una spiaggia si dispongano in modo regolare non è affatto una prova a favore dell'evoluzionismo.
(Come tu sembri pensare.)

Al contrario: un conto è la ben nota capacità della materia di ordinarsi, in modo più o meno simmetrico, in ossequio alle leggi della fisica.

Tutto un altro discorso è la - presunta - capacità della materia inorganica di organizzarsi in materia organica, in tutta la sua immensa complessità.
Nulla di simile è mai stato dimostrato, nemmeno lontanamente.
(Nonostante i tanto strombazzati esperimenti come quello di Miller...)

La materia organica (cioé viva) non è "ordinata", non è simmetrica: è organizzata.
E organizzazione è praticamente sinonimo di intelligenza.

Il primo fenomeno (i ciottoli che si dispongono in modo ordinato e simmetrico), è stato ampiamente studiato e dimostrato: ergo esiste.

Il secondo è ancora nel grande regno dell'immaginazione, così come i pesci che si trasformano in rettili, i rettili che diventano uccelli, e tutte le altre mirabolanti magie che ci raccontano gli evoluzionisti...

La differenza fra le due cose è di tutta evidenza, mi pare.

Kirbmarc
Inviato: 18/8/2007 2:30  Aggiornato: 18/8/2007 2:30
Dubito ormai di tutto
Iscritto: 17/5/2006
Da: Arkadia-spazio profondo
Inviati: 1665
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
In realtà, questa versione è ormai vista come superata dagli stessi evoluzionisti, da quando Eldredge e Gould hanno proposto la loro teoria degli "equilibri punteggiati".

In realtà: punto 1) la teoria degli equilibri punteggiati non propone certo periodi "catastorici",bensì rapidi su scala geologica (50000-100000 anni,tempi rapidi geologicamente doveva i tempi medi sono sui milinioni di anni) ,dovuti a pressioni evolutive più intense-nella metafora dei setacci,setacci a maglie più strette.
Punto 2) le due teorie non sono mutualmente incompatibili. Periodi di maggiore e di minore pressione evolutiva si intervellano nella storia.
Punto 3) il meccanismo di trasmissione e di accumulo delle mutazioni è lo stesso nelle due teorie. La teoria degli equilibri punteggiati è ben diversa dal "rettile che depone un uovo da cui nascerà un uccello" che qualche spiritosone scarsamente informato accennava.
Citazione:
Anche questa nuova teoria è priva di qualsiasi riscontro probatorio, così come quella precedente

Tralasciando il fatto che le due teorie sono differenti solo nei tempi delle evoluzioni effettive, non nei meccanismi di selezione o di trasmissione genetica, i ricontri probatori sono moltissimi.
Comiciamo da qui
abbiamo visto l'evoluzione non in fossile, ma dal vivo centinaia di volte.
da: John A. Endler, "Natural Selection in the Wild",
Princeton, 1986.

Direct demonstrations of natural selection
Species Traits Selective Agent References

Acropora morphology physical factor Potts 1978,1984

Tetranychus host plant host plant Gould 1979
urticae resistance toxicity

Sphaeroma color pattern temperature Bishop 1969,
rugicauda Heath 1974

Cepaea shell size bird predation Wolda 1963,
Nemoralis Knights 1979

Tegula escape Octopus predation Fawcett 1984
funebralis behaviour

Moths melanism bird predation Steward 1977

Lucilia resistance toxicity Witton et. al.
cuprina to diedrin 1980

R. sylvatica male size sexual selection Howard 1980

Domestic
Chickens homeothermy Salmonella infection Hutt 1963

(continua cosi' per una trentina di pagine)
Ecco inoltre alcune nuove specie nate sotto gli occhi degli scienziati, con i loro nomi scientifici:

- Evening Primrose (Oenothera gigas)
- Kew Primrose (Primula kewensis)
- Tragopogon
- Raphanobrassica
- Hemp Nettle (Galeopsis tetrahit)
- Madia citrigracilis
- Brassica
- Maidenhair Fern (Adiantum pedatum)
- Woodsia Fern (Woodsia abbeae)
- Stephanomeira malheurensis
- Maize (Zea mays)
..etc.

altre sono qui:

Observed Instances of Speciation
here
Some More Observed Speciation Events
http://www.talkorigins.org/faqs/speciation.html

Study Illustrates Diversification, Speciation In Biological "Islands"
here

New species arise more quickly than previously believed, UMass researcher finds
here

New animal species evolved in an instant
here

Citazione:
Ma sembra avere il vantaggio di spiegare la desolante mancanza dei famosi anelli di congiunzione (che lo stesso Darwin riteneva dovessero essere innumerevoli).

I fossili intermedi ci sono eccome:

- The horns of titanotheres (extinct Cenozoic mammals) appear in progressively larger sizes, from nothing to prominence. Other head and neck features also evolved. These features are adaptations for head-on ramming analogous to sheep behavior (Stanley 1974).

- A gradual transitional fossil sequence connects the foraminifera Globigerinoides trilobus and Orbulina universa (Pearson et al. 1997). O. universa, the later fossil, features a spherical test surrounding a "Globigerinoides-like" shell, showing that a feature was added, not lost. The evidence is seen in all major tropical ocean basins. Several intermediate morphospecies connect the two species, as may be seen in the figure included in Lindsay (1997).

- The fossil record shows transitions between species of Phacops (a trilobite; Phacops rana is the Pennsylvania state fossil; Eldredge 1972; 1974; Strapple 1978).

- Planktonic forminifera (Malmgren et al. 1984). This is an example of punctuated gradualism. A ten-million-year foraminifera fossil record shows long periods of stasis and other periods of relatively rapid but still gradual morphologic change.

- Fossils of the diatom Rhizosolenia are very common (they are mined as diatomaceous earth), and they show a continuous record of almost two million years which includes a record of a speciation event (Miller 1999, 44-45).

- Lake Turkana mollusc species (Lewin 1981).

- Cenozoic marine ostracodes (Cronin 1985).

- The Eocene primate genus Cantius (Gingerich 1976, 1980, 1983).

- Scallops of the genus Chesapecten show gradual change in one "ear" of their hinge over about 13 million years. The ribs also change (Pojeta and Springer 2001; Ward and Blackwelder 1975).

- Gryphaea (coiled oysters) become larger and broader but thinner and flatter during the Early Jurassic (Hallam 1968).

- Human ancestry. Australopithecus, though its leg and pelvis bones show it walked upright, had a bony ridge on the forearm, probably vestigial, indicative of knuckle walking (Richmond and Strait 2000).

- Dinosaur-bird transitions.

- Haasiophis terrasanctus is a primitive marine snake with well-developed hind limbs. Although other limbless snakes might be more ancestral, this fossil shows a relationship of snakes with limbed ancestors (Tchernov et al. 2000). Pachyrhachis is another snake with legs that is related to Haasiophis (Caldwell and Lee 1997).

- The jaws of mososaurs are also intermediate between snakes and lizards. Like the snake's stretchable jaws, they have highly flexible lower jaws, but unlike snakes, they do not have highly flexible upper jaws. Some other skull features of mososaurs are intermediate between snakes and primitive lizards (Caldwell and Lee 1997; Lee et al. 1999; Tchernov et al. 2000).

- Transitions between mesonychids and whales.

- Transitions between fish and tetrapods.

- Transitions from condylarths (a kind of land mammal) to fully aquatic modern manatees. In particular, Pezosiren portelli is clearly a sirenian, but its hind limbs and pelvis are unreduced (Domning 2001a, 2001b).

- The Cambrian fossils Halkiera and Wiwaxia have features that connect them with each other and with the modern phyla of Mollusca, Brachiopoda, and Annelida. In particular, one species of halkieriid has brachiopod-like shells on the dorsal side at each end. This is seen also in an immature stage of the living brachiopod species Neocrania. It has setae identical in structure to polychaetes, a group of annelids. Wiwaxia and Halkiera have the same basic arrangement of hollow sclerites, an arrangement that is similar to the chaetae arrangement of polychaetes. The undersurface of Wiwaxia has a soft sole like a mollusk's foot, and its jaw looks like a mollusk's mouth. Aplacophorans, which are a group of primitive mollusks, have a soft body covered with spicules similar to the sclerites of Wiwaxia (Conway Morris 1998, 185-195).

- Cambrian and Precambrain fossils Anomalocaris and Opabinia are transitional between arthropods and lobopods.

- An ancestral echinoderm has been found that is intermediate between modern echinoderms and other deuterostomes (Shu et al. 2004).
Da qui.
Citazione:
Darwin liberale moderato - teoria dei mutamenti graduali e "passo passo"
Gould marxista - teoria del mutamento improvviso, catastrofico e "rivoluzionario"...

Se volevi fare dell'umorismo,forse dovevi sforzarti un pò di più. Se inveve stai parlando seriamente,ti consiglio di cominciare a studiare realmente non solo la biologia,ma proprio il vocabolario,sotto la voce "scienza" prima, e quella "politica" poi. E forse per te è davvero meglio non aggirarsi per forum a tarda notte, se questi sono i risultati.

Kirbmarc
Inviato: 18/8/2007 2:40  Aggiornato: 18/8/2007 2:42
Dubito ormai di tutto
Iscritto: 17/5/2006
Da: Arkadia-spazio profondo
Inviati: 1665
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
La materia organica (cioé viva) non è "ordinata", non è simmetrica: è organizzata.
E organizzazione è praticamente sinonimo di intelligenza.

Sinonimo di organica. Prima di strombazzare in neretto parole come "vita" e Intelligenza, sarebbe bene cercare di capire in che cosa,consiste questa famosa specificità della "vita" rispetto al resto. Un virus è organico, ma molti virus sono addirittura in grado di autoassemblarsi, senza il minimo bisogno non solo di disegni intelligenti,ma persino di una "traccia" di DNA da seguire.
Citazione:
Il primo fenomeno (i ciottoli che si dispongono in modo ordinato e simmetrico), è stato ampiamente studiato e dimostrato: ergo esiste.

Non dimostrato bensì osservato. Le dimostrazioni ci sono in matematica,non in biologia (dove al massimo ci sono le validazioni o meglio ancora le invalidazioni).
Citazione:
Il secondo è ancora nel grande regno dell'immaginazione

Falso. Nel post precedente ti ho già elencato una piccola parte dell'enorme quantitativo di prove dell'evoluzionismo.
Citazione:
così come i pesci che si trasformano in rettili, i rettili che diventano uccelli, e tutte le altre mirabolanti magie che ci raccontano gli evoluzionisti...

E infatti non "si trasformano" magicamente in una generazione, sei tu a non aver capito nulla o quasi della teoria degli equilibri punteggiati e ad usare frasi ad effetto,attribuendo ad altri quello che non affermano loro ma appunto i loro avversarii (cioè che le specie appaiono magicamente e in un istante.).
Dì qualcosa di più concreto e usa meno retorica.
Citazione:
Il fatto che i ciottoli di una spiaggia si dispongano in modo regolare non è affatto una prova a favore dell'evoluzionismo.

E infatti nel testo (non mio,ma di Richard Dawkins) non si sostiene affatto che questa sia una prova dell'evoluzione (le prove sono ben altre,come abbiamo visto). Si tratta di una analogia per chiarire il concetto di selezione naturale.Rileggi con più attenzione.

Oldboy
Inviato: 18/8/2007 2:41  Aggiornato: 18/8/2007 2:41
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Kirbmarc,

grazie per il gentile consiglio: ne farò tesoro.
Tu, però, cerca almeno di sembrare educato, se non di esserlo.
(Io non insulto e non sfotto nessuno, quindi gradirei un minimo di reciprocità.)

Quanto all'"umorismo" che hai creduto di vedere nelle mie parole, ti sbagli.

Il nesso fra struttura e sovrastruttura non è mai stato così evidente:
il liberale moderato Darwin sosteneva un'evoluzione graduale, passo passo, quasi impercettibile.

Il marxista Gould, viceversa, sosteneva una versione aggiornata dell'evoluzione: improvvisa, catastrofica, rivoluzionaria.

Nessuna ironia, quindi: solo l'evidenza palmare di un nesso chiaro come l'acqua.

Oldboy
Inviato: 18/8/2007 2:50  Aggiornato: 18/8/2007 2:50
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Kirbmarc,

un'ultima osservazione.
(Ultima perché, evidentemente, non riesci a scrivere due righe senza insultare e sfotticchiare.)

Quando mai ho scritto che, secondo Gould, i mutamenti avvengono "in una generazione?"
Mai, quindi risparmiami i tuoi "non hai capito", "leggi meglio", e simili sermoncini.

Ho scritto, in buon italiano, che secondo la nuova versione dell'evoluzionismo i mutamenti sono "improvvisi e rivoluzionari", ma solo rispetto alla vecchia versione "gradualista".
So bene che nessuno afferma siano avvenuti, letteralmente, dall'oggi al domani.

Kirbmarc
Inviato: 18/8/2007 2:52  Aggiornato: 18/8/2007 3:01
Dubito ormai di tutto
Iscritto: 17/5/2006
Da: Arkadia-spazio profondo
Inviati: 1665
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Tu, però, cerca almeno di sembrare educato, se non di esserlo

E' difficile rimanere educato di fronte a commenti come il tuo,purtroppo.
Specialmente se si pensa che provengano da una persona in grado di cogliere la differenza fra le teorie scientifiche e le ideologie politiche.
Se poi non sei in grado di farlo,mi spiace per te.
Citazione:
Nessuna ironia, quindi: solo l'evidenza palmare di un nesso chiaro come l'acqua.

E perchè non parlare del reazionario Newton, che tendeva all'accentramento delle masse con la sua esiziale teoria della relatività, superato poi dal radicale e massonico Einstein,che con la sua teoria dello spazio curvo tendeva a riprodurre nelle menti la fascinazione per le curve della donna (sappiamo bene come i massoni siano maestri nell'includere in ogni opera occulti riferimenti al sesso...)?
O della teoria dell'eretico e innovatore Galileo,che con il suo nuovo sistema eliocentrico toglieva all'essere umano il suo primato per darlo al sole, simbole del potere del signore laico contro la Santa Romanissima Chiesa?

Mi verrebbe da rispondere con quest'unica frase "Ma mi faccia il piacere!"

Kirbmarc
Inviato: 18/8/2007 3:00  Aggiornato: 18/8/2007 3:00
Dubito ormai di tutto
Iscritto: 17/5/2006
Da: Arkadia-spazio profondo
Inviati: 1665
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Ho scritto, in buon italiano, che secondo la nuova versione dell'evoluzionismo i mutamenti sono "improvvisi e rivoluzionari", ma solo rispetto alla vecchia versione "gradualista".

E io ti ho risposto che in ogni caso questo è inifluente ai fini della nostr discussione, perchè si tratta comunque di tempi lunghi sulla scala delle generzioni (e quindi di decini di migliaia di generazioni) e che l'unica differenza fra equilibri punteggiati e "gradualismo" (fra l'altro non mutuamente incompatibili,come ho scritto) è nella entità della pressione evolutiva (in metafora,nella larghezza delle maglie del setaccio.
Dunque la tua era un osservazione inutile.
Citazione:
So bene che nessuno afferma siano avvenuti, letteralmente, dall'oggi al domani.

Da quello che scrivi nei tuoi post non si direbbe,dato che parli di "rettili che si trasformano in uccelli" frase che travisa completamente il senso della teoria degli equilibri punteggiati.
Ma probabilmente si trattava della tua ironia non ironica.

Oldboy
Inviato: 18/8/2007 3:02  Aggiornato: 18/8/2007 3:04
Mi sento vacillare
Iscritto: 20/7/2007
Da:
Inviati: 411
 Re: Gli anelli mancanti continuano ad aumentare
Anche a me dispiace per te, Kirbmarc, visto che proprio non ti riesce di discutere senza esprimere disprezzo e compatimento per chi non la pensa come te.

Dormiamoci sopra, è meglio.

Kirbmarc
Inviato: 18/8/2007 3:14  Aggiornato: 18/8/2007 3:17
Dubito ormai di tutto
Iscritto: 17/5/2006
Da: Arkadia-spazio profondo
Inviati: 1665
 Re: Gli anelli mancanti continuano ad aumentare
Questo sito comunque non è adatto alla discussione di un argomento tanto complesso,data anche la palese abissale ignoranza in argomento dello stesso gestore, che continua a ripetere tiritere già ampiamente smontate senza capirci peraltro nulla.
E aggiungerei che il sito recentemente sta decadendo sempre più anche nelle sezioni sull'Undici Settembre ,basta notare l'alta percentuale di bannati/latitanti dai forum, e la vena decisamente delirante che stanno prendendo i forum stessi.
Complimenti,siete riusciti a diventare lo zimbello anche della cosiddetta "controinformazione" che ormai schifa Luogocomune e che voi schifate di rimando (vedi Beppe Grillo,ma per voi è sicuramente un gatekeeper,come io per voi sarò sicuamente un debunker ,dato che ormai siete refrattari a qualsiasi tipo di critica razionale).
Dopo questo post sicuramente la "carica degli eroi" mi darà addosso, e questo mi costerà il ban dal sito,ma non ha importanza,visto che in ogni caso avevo deciso di non passare più da queste parti.
Alle persone intelligenti (non poche) che stazionano qui dico solo che "unire i puntini" qualche volta va fatto anche con i nostri "capi" e che in fondo il nemico marcia sempre alla nostra testa.
Agli altri,quelli che farranno scempio di questo commento e si infurieranno a morte,dico solo: ricordatevi di guardare sotto il letto la sera, che magari riuscite a beccare l'Uomo Nero mentre se ne va.
Comunque il countdown è cominciato: quanto resisterà questo commento alla censura?

Redazione
Inviato: 18/8/2007 9:55  Aggiornato: 18/8/2007 9:59
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
Caro Kirbmark, il tuo commento è talmente ridicolo che nessuno si infurierà, e nessuno si abbasserà mai per cancellarlo.

E nemmeno ti banneremo per quello.

Pensa che sfiga: resterà lì, alla vista di tutti, a testimonianza imperitura della tua intelligenza abissale (anzi, se vuoi postarne un altro, in coppia fanno una figura ancora migliore).

Anonimo
Inviato: 18/8/2007 11:30  Aggiornato: 18/8/2007 11:30
 Re: Gli anelli mancanti continuano ad aumentare
OldBoy, ma perché appena qualcuno ti fa notare che quello che scrivi non è corretto inizi a frignare e dici "non ci gioco più"?

Kirbmark ti ha dato velatamente dell'ignorante (come hanno fatto altri in precedenza) perché purtroppo tu così appari.
"Ignorante" non è propriamente un'offesa, semplicemente hai ampiamente dimostrato che la tua conoscenza dell'argomento è alquanto superficiale.

Anche se in realtà, per quanto mi riguarda, più che ignoranza la tua è semplice malafede.
Ti abbiamo dimostrato più e più volte l'inconsistenza delle tue (che poi sono sempre parole degli altri) argomentazioni.
In risposta o ne hai tirate fuori altre allo stesso livello, o hai saltato a pié pari l'argomento.

Così come hai dimostrato di non leggere i contributi precedenti, non credo che ora tu ti sia preso la briga di leggere quelle che Kirbmark ti ha offerto come prove.

Se vuoi fare il cieco difensore di un dogma, non lamentarti però quando te lo fanno notare. Purtoppo, per chi è elastico di mente, un atteggiamento oscurantista è molto ma molto più offensivo delle parole esplicite.

A proposito, ho chiesto a Massimo (estendendo l'invito a tutti) come crede che siano andate le cose, e lui ci ha risposto.

Puoi, cortesemente, dirci come sono andate per te le cose?

olah
Inviato: 18/8/2007 12:23  Aggiornato: 18/8/2007 14:54
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Questo sito comunque non è adatto alla discussione di un argomento tanto complesso


Kirbmarc, non prendertela troppo, nei forum è normale che alcuni siano più rigorosi e altri meno, non penso che altrove si sarebbe fatto di meglio, ad eccezione dei forum scientifici rigidamente moderati dove però gli argomenti sono pù circoscritti e i partecipanti sono culturalmente più omogenei.
Per quel che riguarda Oldboy, dai post precedenti avresti potuto prevedere le sue reazioni, per cui inutile arrabbiarsi, sapendo di non poter aprire con lui un dialogo su basi scientifiche fondato sulla ragione. Anzi, io A proposito, mi scuso con lui per avergli dato del troll, quando l'ho capito.

Penso che i tuoi interventi siano stati preziosi e ti ringrazio moltissimo per l'elevato numero di riferimenti e di citazioni, a mio parere molto utili per chi è interessato all'argomento. Ti invito quindi a non lasciarci solo per qualche dissapore con una parte dei partecipanti.

olah
Inviato: 18/8/2007 13:38  Aggiornato: 18/8/2007 13:52
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:

Non ti chiedo nessuna dimostrazione, ma solo per curiosità, per te cosa è successo?

Naturalmente lo stesso invito è aperto a tutti gli altri.


OK, questa è la mia visione:

Siamo il risultato di una reazione a catena antica quanto il tempo che produce architetture complesse in continua trasformazione, con una progressione non lineare. La nostra biosfera è parte di questa architettura e le sue trasformazioni ci appaiono a volte lente e graduali, altre volte rapide e catastrofiche (come dimostrano le cinque grandi estinzioni in massa più una serie di estinzioni più piccole).
In maggior dettaglio, le specie viventi evolvono grazie alle mutazioni del proprio patrimonio genetico, acquisendo fenotipi ereditabili che favoriscono la crescita e la riproduzione degli individui che meglio si adattano all'ambiente.

olah
Inviato: 18/8/2007 14:24  Aggiornato: 18/8/2007 14:33
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Ora io non conosco scimmie, ma per fortuna mia figlia, che ha 11 mesi, è un ottimo dispositivo generatore di casualità, ed ha accettato con entusiasmo il ruolo di scimmia dattilografa.


La bimba ha delle preferenze, non le piacciono molto le lettere ai margini della tastiera come la Q o la P. Ha fatto bene a licenziarla come scimmia dattilografa e a dare il suo posto a un computer.

Anonimo
Inviato: 18/8/2007 17:59  Aggiornato: 18/8/2007 18:00
 Re: Gli anelli mancanti continuano ad aumentare
Ho letto una prova anti-evoluzionista davvero bella.

Non è vero che i dinosauri si sono estitni prima che apparissero gli esseri umani. Hanno convissuto. Altrimenti non si spiegherebbero i racconti ed i dipinti riguardanti i draghi e gli altri mostri. Ed i nostri antenati di sicuro erano meno maliziosi di noi, quindi non avrebbero mai dipinto né raccontato cose senza un fondamento di realtà.

Che dire?

......

Redazione
Inviato: 18/8/2007 19:18  Aggiornato: 18/8/2007 19:20
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
"Non è vero che i dinosauri si sono estitni prima che apparissero gli esseri umani. Hanno convissuto. Altrimenti non si spiegherebbero i racconti ed i dipinti riguardanti i draghi e gli altri mostri."


Brutale fallacia del falso dilemma: presume che "o una cosa la vedi di persona", "oppure non puoi disegnarla nè raccontarla". Esclude, ad esempio, la possibilità che siano stati "altri" a raccontare agli umani di quelle strane creature. Oppure esclude che le abbiano viste in sogno. Oppure esclude la casualità, tanto cara ai materialisti, in cui gli umani abbiano disegnato "per caso" bestie simili a quelle esistite.

Come vedete, fanno già 5 possibilità - e non 2 - e ancora non ho bevuto il caffè.

Anonimo
Inviato: 18/8/2007 21:18  Aggiornato: 18/8/2007 21:18
 Re: Gli anelli mancanti continuano ad aumentare
Infatti, l'esempio l'ho portato apposta per far capire quanto ridicole possano essere le teorie creazioniste, o contro-evoluzioniste.

Eppure c'è chi a queste cose ci crede davvero, ma ci crede nel senso che ci dedica la vita e l'anima...

Purtroppo ci vuole il giusto tempo per tutto.

sitchinite
Inviato: 19/8/2007 12:49  Aggiornato: 19/8/2007 12:49
Sono certo di non sapere
Iscritto: 3/6/2007
Da: Roma - Pomezia
Inviati: 3270
 Re: Gli anelli mancanti continuano ad aumentare
Redazione ha scritto:

Citazione:

Brutale fallacia del falso dilemma: presume che "o una cosa la vedi di persona", "oppure non puoi disegnarla nè raccontarla". Esclude, ad esempio, la possibilità che siano stati "altri" a raccontare agli umani di quelle strane creature. Oppure esclude che le abbiano viste in sogno. Oppure esclude la casualità, tanto cara ai materialisti, in cui gli umani abbiano disegnato "per caso" bestie simili a quelle esistite.



Stupenda risposta, che proverei ad analizzare un pò più a fondo (ci provo io ma vorrei che anche voi ci provaste):

1) Altri avrebbero raccontato agli umani di quelle creature:
Chi sono gli 'Altri'? Forse questi:


(personalmente propendo per questa ipotesi)

2) viste in sogno...
non saprei, generalmente in psicologia si ammette che i sogni son costituiti da immagini che fanno GIA' parte del nostro bagaglio di informazioni, che in fase onirica vengono riadattate e distorte.
Possibile comunque che sia così, visto che la mente 'crea' forme nuove sempre a partire da quelle che conosce già...

3) disegnate per caso:
molto probabile anche questo... in effetti il livello di dettaglio dei dipinti rupestri é molto scarso, noi ci vediamo un dinosauro ma potrebbe essere qualcos' altro, magari un asemplice animale che coabitava con gli uomini primitivi, e che loro hanno disegnato in maniera distorta x dimensioni e proporzioni.

Io aggiungerei una altra ipotesi:
NON TUTTI i dinosauri sono estinti nell' evento K/T e successivi sconvolgimenti climatici/riassestamenti.
Daltronde negli ultimi decenni son stati scoperti esemplari ancora vivi di Celocanti, e ancora oggi in alcune sone del deserto centrooccidentale africano si hanno avvistamenti di 'mostri' che son stati ipotizzati essere dinosauri sopravvissuti e evolutisi.

javaseth
Inviato: 19/8/2007 14:19  Aggiornato: 19/8/2007 14:19
Dubito ormai di tutto
Iscritto: 11/3/2006
Da:
Inviati: 1182
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Infatti, l'esempio l'ho portato apposta per far capire quanto ridicole possano essere le teorie creazioniste, o contro-evoluzioniste.

Eppure c'è chi a queste cose ci crede davvero, ma ci crede nel senso che ci dedica la vita e l'anima...

Purtroppo ci vuole il giusto tempo per tutto.


Già, ci vuole il tempo giusto.....diciamo due o tre generazioni!

Dal Corriere

La sessuologa: «Una rivoluzione, tra due o tre generazioni»

Veronesi: «L'umanità sarà bisessuale» L'oncologo: «Si farà l'amore per affetto e non per riprodursi. È il prezzo positivo pagato dall'evoluzione naturale della specie»


MILANO — Il futuro? È bisessuale. Parola di Umberto Veronesi. Intervistato ieri dal Riformista, l'oncologo ex ministro della Salute immerso nella quiete estiva di Capalbio ha scosso l'atmosfera con una tesi che fa già discutere. La specie umana — dice Veronesi — si va evolvendo verso un «modello unico», le differenze tra uomo e donna si attenuano (l'uomo, non dovendo più lottare come una volta per la sopravvivenza, produce meno ormoni androgeni, la donna, anche lei messa di fronte a nuovi ruoli, meno estrogeni) e gli organi della riproduzione si atrofizzano. Questo, unito al fatto che, tra fecondazione artificiale e clonazione, il sesso non è più l'unica via per procreare, finirà col privare del tutto l'atto sessuale del suo fine riproduttivo. Il sesso resterà — avverte l'oncologo — ma solo come gesto d'affetto, dunque non sarà più così importante se sceglieremo di praticarlo con un partner del nostro stesso sesso.


continua...

Ciao
-javaseth

P.S. A Veronesi levateje er viiiiinoooooooo...

PP.SS. Bean me up, Santa!

"..io vi mando come pecore in mezzo ai lupi; siate dunque prudenti come serpenti e semplici come colombe"
Timor
Inviato: 19/8/2007 14:45  Aggiornato: 19/8/2007 14:45
Mi sento vacillare
Iscritto: 14/11/2005
Da:
Inviati: 639
 Re: Gli anelli mancanti continuano ad aumentare
Non pensavo Veronesi così preveggente.

Peccato soltanto che il suo livello di codifica rimanga prettamente biologico-sociale.

E voi non vi siete accorti che vi state trasformando ?

Anime libere cosa cercate nell'altro al di là di quello che vi è stato culturalmente imprintato?

"Il vero Big Bang è la nascita di una coscienza"

"Visita Interiora Terrae Rectificando Invenies Occultum Lapidem"
Pausania
Inviato: 19/8/2007 22:28  Aggiornato: 19/8/2007 22:38
Sono certo di non sapere
Iscritto: 6/4/2006
Da:
Inviati: 3872
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Questo sito comunque non è adatto alla discussione di un argomento tanto complesso,data anche la palese abissale ignoranza in argomento dello stesso gestore, che continua a ripetere tiritere già ampiamente smontate senza capirci peraltro nulla.

Qual buon vento
Vedi Kirbmark, tu stai fraintendendo questo luogo. Questo è certamente un luogo per discutere, ma essendo aperto a tutti, senza filtri di sorta, tutti possono dire la loro. Ma dire la propria non significa cercare di convertire l'altra parte. La discussione anche accesa serve soprattutto a chi legge e magari non interviene per farsi un'idea - grossomodo - dello status quaestionis.

Prendi questo thread, ad esempio.

Da un lato creazionisti, dall'altro lato persone che hanno alle spalle studi scientifici e una decisa conoscenza della materia. Per me che leggo e non intervengo, perché non sufficientemente preparato in materia, è stato davvero interessante leggere una discussione accesa ma corretta.

E credo lo sia stato per molti. E' sempre un piacere leggere le parole di utenti preparati in materie - in questo caso la biologia - interessanti ma che richiedono un'alta preparazione.

Abbiamo così visto che le critiche alle teorie evoluzionistiche si fondano su argomenti sbagliati e non metodologicamente corretti e che il motivo per cui i creazionisti attaccano l'evoluzionismo è per fornire al povero utente di Lc la storia del Creatore che un bel giorno si mette a creare (ed estinguere) le diverse forme di vita, senza uno scopo preciso, a dire il vero.

Abbiamo anche imparato che uno dei creazionisti più in voga è una specie di biscazziere in fregola, amante delle minorenni, che non sa nulla di biologia ma che trova enormi fondi non si sa dove per regalare il suo libro illustrato in cui ci dice che il Corano dimostra l'esistenza di Dio.

Credo che miglior servizio alla scienza e alla razionalità non si potesse fare...

Quindi, caro Kirbmarc, devi capire che non siamo qui per fare proseliti o per far cambiare idea alle persone. Siamo qui per discutere e scambiare parere con tutti. Il fatto che alcuni non ci diano ragione non significa che tutti siano contro di noi.

Se poi a te il tono delle discussioni non piace, non hai che da elevarlo tu stesso, offrendo quello che sai e sapendo che il buono di una discussione non è far cambiare idea alla persona a cui parli, ma mettere a disposizione di chi non sa una parte del proprio sapere.

D'altronde guarda, per farti un esempio, quando scrissi di Guerre Persiane e Greci, fosti tu ad aprire una discussione dimostrando chiaramente di non conoscere a fondo certe problematiche, e difatti il thread si dedicò dopo tre post ai fumetti, argomento più semplice ed apprezzato.
Io allora non me la presi certo perché criticasti il mio articolo senza averne capito nulla, perché non era mio intento scrivere per convicerti delle mie tesi. Io ho solo messo sul tavolo quello che avevo, spero che a qualcuno sia servito, e poco importa se altri non lo hanno apprezzato.

Per il resto cosa vuoi che ti dica? Sono 27 anni che mi trattano da deficiente per le mie idee, fra poco sarò in bancarotta a meno di un miracolo, sono pure emigrante, non sarà certo quello che pensa Grillo, che fa i miliardi gridando "vaffanculo" da un palco a impensierirmi. Se al resto della controinformazione non piace LC, non hanno che da evitare di digitarne l'url e siamo tutti tranquilli e sereni, non ti pare?


=========

EDIT: comunque ecco la versione più credibile dell'intelligent design

http://www.youtube.com/watch?v=12be66jP1tg

Redazione
Inviato: 20/8/2007 3:52  Aggiornato: 20/8/2007 4:12
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
PAUSANIA: Appoggio in pieno il tuo intervento, eccetto per questo paragrafo, nel quale secondo me ti sei "allargato" un pò troppo: Citazione:
Abbiamo così visto che le critiche alle teorie evoluzionistiche si fondano su argomenti sbagliati e non metodologicamente corretti e che il motivo per cui i creazionisti attaccano l'evoluzionismo è per fornire al povero utente di Lc la storia del Creatore che un bel giorno si mette a creare (ed estinguere) le diverse forme di vita, senza uno scopo preciso, a dire il vero.


Non so a chi tu ti riferisca con "creazionisti", ma il mio scopo - che "creazionista" in senso stretto, fra l'altro, non lo sono affatto - non è certamente quello che suggerisci tu.

Per quel che riguarda gli altri utenti, direi che ciascuno tira l'acqua al suo mulino: lo fanno sia i creazionisti che gli evoluzionisti, nella stessa identica misura. Solo che la pagliuzza nell'occhio altrui è sempre più facile da vedere.

Per quel che mi riguarda, io ho posto - e credo altri con me - una domanda basata sul buon senso, e non mi basta certo sentirmi dire che "il turco sbaglia metodo" per convincermi dell'invalidità della mia domanda.

Quello è lo stesso trucco "generalista" che usano Attivissimo & Company,("Mazzucco sbaglia nel contare i piani delle Torri Gemelle, quindi tutto quello che dice non vale niente"), e mi stupisce che tu lo abbia fatto tuo con tanta facilità.

Potrà anche aver sbagliato qualcosa, il nostro turco, ma io la confutazione generale del suo discorso non l'ho affatto vista.

Per non parlare poi dell'argomento ad personam, da te in questo caso decisamente abusato ("una specie di biscazziere in fregola, amante delle minorenni, che non sa nulla di biologia ma che trova enormi fondi non si sa dove per regalare il suo libro illustrato in cui ci dice che il Corano dimostra l'esistenza di Dio." Mamma mia, quasi da enciclopedia).

Per il resto, sono interamentre d'accordo con te: su luogocomune si discute in libertà, e chi non ama questo sito può andare tranquillamente altrove.

eco3
Inviato: 20/8/2007 11:21  Aggiornato: 20/8/2007 11:21
Ho qualche dubbio
Iscritto: 4/10/2006
Da:
Inviati: 229
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Purtroppo ci vuole il giusto tempo per tutto.


Anche per ciò che a tutt'oggi potrebbe essere considerata una pia illusione: l'evolversi degli evoluzionisti.

motus in fine velocior
Anonimo
Inviato: 20/8/2007 12:05  Aggiornato: 20/8/2007 12:06
 Re: Gli anelli mancanti continuano ad aumentare
"Citazione:
Potrà anche aver sbagliato qualcosa, il nostro turco, ma io la confutazione generale del suo discorso non l'ho affatto vista.


Oki, esaminiamo tutto il discorso.

Su tutta la parte "Le proteine sfidano il caso" spero non ci sia più nulla da dire, visto che è tutta basata sui famosi calcoli probabilistici sballati, e sulle premesse biochimiche "ignorevoli".

Esaminiamo ora "Proteine sinistrorse".

Anche qui parte da un premessa fallace. Poiché le proteine in natura sono formate solo da levogiri, allora le probabilità si abbassano ancora di più.
Ma perché? Come se io mangiassi solo pizza diavola, allora è più difficile che io ceni? Vado in pizzeria e trovo sia la diavola che la margherita.
Naturalmente è vero che non si sa perché "la natura" abbia scelto sono i levogiri, ma di sicuro ha a che fare con l'armonia di cui Massimo tu parlavi all'inizio.
(Io continuo a sostenere che in fondo stiamo dicendo la stessa cosa...).

Anche l'esempio della monetina lanciata mille volte.
Non è che c'è un sacchetto, con entrambi i tipi di aminoacidi, e si pesca a caso da lì, sperando che non esca mai un destrogiro. Il discorso è rovesciato, non c'è nessun caso, ma sono leggi della biochimica che portano i levogiri ad unirsi tra di loro.

E no, non c'è bisogno che siano vivi. Come l'esempio del Virus, non è vivo, ma fa le stesse cose che fa un essere vivente.

Magia? Intervento divino? No, mere interazioni chimiche. Che, ripeto fino alla noia, sottostanno a precise e ferre regole, che derivano dalle forze molecolari ed atomiche in gioco.

Spero anche che il "per concludere" non abbia bisogno di mezza parola.

Questo è quello che ho desunto dal discorso del Turco.

Massimo, se c'è qualcosa che non ti quadra, o che ho saltato, cortesemente, me lo fai notare?

Voglio ripetere per la 2.5x10^490 volta, non voglio avere ragione, non cerco di indottrinare nessuno con la mia versione (anche perché non c'è), ma non mi sta bene che si usino falsi-scientifici/matematici per cercare di smontare qualcosa.

Davide71
Inviato: 20/8/2007 12:43  Aggiornato: 20/8/2007 12:43
Dubito ormai di tutto
Iscritto: 8/7/2006
Da:
Inviati: 2108
 Re: Gli anelli mancanti continuano ad aumentare
Ciao Morfeo: visto che sei convinto che le leggi chimiche sono ferree, e lo sono convinto anch'io, vediamo alcuni punti:
1) le proteine, allo stato attuale delle nostre conoscenze, possono essere create SOLO all'interno delle cellule; in chimica, per costruire una molecola, occorre seguire dei passaggi... al di fuori dell'ambiente cellulare nessuna proteina può essere fabbricata.

Da ciò ne consegue che la probabilità di fabbricare una proteina "casualmente" é 0 (zero). L'evento é impossibile adesso come 1 milione o un miliardo di anni fa.

Oppure le leggi della chimica sono ferree solo quando fanno comodo a qualcuno.

D'altronde gli scienziati ridacchiano quando pensano che nel Medioevo ritenessero che le mosche nascessero dalla Terra. Salvo poi dire che la vita ha avuto origine proprio in quel modo tato tanto tempo fa...

Per quanto riguarda lo sfogo di Kirbmarc gli raccomando di essere paziente. Se Mazzucco avesse ragionato come te, dicendo per esempio:

1) le questioni di ingegneria implicate negli eventi dell'11 settembre sono al di fuori della comprensione della gente;

2) il panorama sordido che deriva dalla verità sull'11 settembre non sarebbe mai accettato dalla gente;

di conseguenza é inutile parlarne...

tu e molti altri ci culleremmo (scusate l'anacoluto) in un mondo di buoni e di cattivi uscito dai fumetti della Marvel.

Io per esempio sono anni che cerco di spiegare che il caso non é una "causa" scientifica, per cui l'evoluzionismo non é una teoria scientifica, finora senza successo.

Non date le perle ai cani e ai porci perchè non le mangeranno e vi si rivolteranno contro.
Anonimo
Inviato: 20/8/2007 12:58  Aggiornato: 20/8/2007 12:59
 Re: Gli anelli mancanti continuano ad aumentare
Davide ti invito a leggere questo articolo.

Davide71
Inviato: 20/8/2007 13:09  Aggiornato: 20/8/2007 13:09
Dubito ormai di tutto
Iscritto: 8/7/2006
Da:
Inviati: 2108
 Re: Gli anelli mancanti continuano ad aumentare
Lasciami n po' di tempo per leggerlo. Peraltro io non sostengo la teoria creazionista. Neanche quella é una teoria scientifica; la volontà divina é altrettanto antiscientifica del caso. Anzi in realtà sono due termini che esprimono lo stesso concetto con due punti di vista diversi.
Quello che io auspico é una prosecuzione degli studi sulla Storia della vita sulla Terra. Senza pregiudizi di sorta. Cosicché un giorno potremo dire "i dinosauri si sono trasformati in uccelli perché..." oppure: "Gli uccelli sono comparsi sulla Terra perché..."

Non date le perle ai cani e ai porci perchè non le mangeranno e vi si rivolteranno contro.
Clorofilla
Inviato: 20/8/2007 14:09  Aggiornato: 20/8/2007 14:10
Mi sento vacillare
Iscritto: 6/7/2006
Da:
Inviati: 859
 Re: Gli anelli mancanti continuano ad aumentare
Da OldboyCitazione:
) La demolizione del darwinismo è opera di fior di scienziati: biochimici, matematici, astronomi, filosofi della scienza.


Ma...sarà...ho comprato Le Scienze di agosto per leggerelo sulla spiaggia e ci sono un paio di articoli con cenni al caso, in uno, e al Dna e dintornii nell'altro, dove sbuca fuori il nome di Shapiro.
Sembra che anche costui, per come viene messa la faccenda, assomigli ad un detrattore dell'evoluzione e della teoria di Darwin.
Da quel che ho potuto capire invece dall'articolo, J. Shapiro non negherebbe l'evoluzione, ma propone di spostare l'attenzione, soprattuto per l'origine della vita, anche su altre molecole, oltre a Dna e Rna, che potrebbero aver avuto meccanismi di sintesi e replicazione.

Già ti ho fatto notare la posizione di Hoyle e Wickramasinghe sull'origine della vita. Non è che forse le fonti da cui trai tutti questi benedetti scienziati anti-evoluzione o anti-qualcosa sono un pò taroccate?

Anche le tue citazioni filosofiche su Darwin, le razze ecc...servono a qualcosa alla fine per sbrogliare la matassa di dati sull'evoluzione? Confondi la deriva filosofica o la strumentalizzazione con il dato scientifico nudo e crudo.

Per quel che ti posso dire, almeno sulle razze, l'antropolgia moderna pone ogni tipo umano su un livello orizzontale e non verticale.

Pausania
Inviato: 20/8/2007 14:53  Aggiornato: 20/8/2007 14:53
Sono certo di non sapere
Iscritto: 6/4/2006
Da:
Inviati: 3872
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Non so a chi tu ti riferisca con "creazionisti", ma il mio scopo - che "creazionista" in senso stretto, fra l'altro, non lo sono affatto - non è certamente quello che suggerisci tu.

Infatti non mi riferivo a te, che hai detto che l'evoluzione esiste ma che non c'è alcuna dimostrazione scientifica che spieghi la nascita della vita (cosa che qualunque scienziato direbbe, tra l'altro).

Mi riferivo ai creazionisti nel senso di coloro che hanno dato vita alle teorie creazioniste, o alla loro variante post moderna, Dio il creatore intelligente. Ovviamente.


Citazione:
Per quel che riguarda gli altri utenti, direi che ciascuno tira l'acqua al suo mulino: lo fanno sia i creazionisti che gli evoluzionisti, nella stessa identica misura. Solo che la pagliuzza nell'occhio altrui è sempre più facile da vedere

In questo caso non è proprio così. L'evoluzionista cerca di spiegarsi il mondo che lo circonda in base alle conoscenze a disposizione, il creazionista cerca di smontare le teorie evoluzioniste per rifilarmi la storiella di Dio del creatore intelligente. A me (e questo è soggettivo, naturalmente) la seconda opzione mi puzza tanto, ma tanto proprio...


Citazione:
Per quel che mi riguarda, io ho posto - e credo altri con me - una domanda basata sul buon senso, e non mi basta certo sentirmi dire che "il turco sbaglia metodo" per convincermi dell'invalidità della mia domanda.

E la risposta è stata che la domanda poggia su fondamenta sbagliate. Il buon senso a volte non basta. Il turco non è che sbaglia metodo, non sa proprio quello che dice, e lo fa per dirci che Allah ha creato il mondo.
Ovviamente ognuno è convinto di quello che gli pare, ma al lettore che non partecipa non si può certo sopprimere l'opinione.


Citazione:
Quello è lo stesso trucco "generalista" che usano Attivissimo & Company,("Mazzucco sbaglia nel contare i piani delle Torri Gemelle, quindi tutto quello che dice non vale niente"), e mi stupisce che tu lo abbia fatto tuo con tanta facilità.

Vabbè Massimo, diciamo che il vasino era stretto, per 'sta volta...
Io ho detto che il turco ha detto una marea di stupidaggini rispetto all'argomento in questione, quindi non sa niente dell'argomento in questione. Mi sembra ragionevole.


Citazione:
Potrà anche aver sbagliato qualcosa, il nostro turco, ma io la confutazione generale del suo discorso non l'ho affatto vista

Per forza non l'hai vista: come pensi si possa confutare la fede di qualcuno? Hai mai sentito nessuno confutare la Bibbia? Non si può, perché fede e ragione pertengono ad ambiti diversi. Si possono confutare dei ragionamenti e delle tesi, ma non si possono confutare le fedi. E' come dimostrare la non esistenza di Dio. Non ha senso.

Però se poi il fedele cerca di appiopparmi la sua fede attraverso errati discorsi scientifici, io avrò ben il diritto di fargli notare che i suoi argomenti scientifici sono errati, o no? Non mi interessa smontare la sua fede, e quindi non mi metto a confutare la sua fede.


Citazione:
Per non parlare poi dell'argomento ad personam, da te in questo caso decisamente abusato

Beh, il tipo è un losco figuro che non si sa cosa faccia nella vita, con la passione per le minorenni e soldi a palate che escono da non si sa dove, che non sa niente di biologia ma che parla di biologia nel goffo tentativo di farmi convertire alle parole del profeta Mohammed (che la benedizione scenda su di lui). C'è un qualche motivo al mondo per cui dovrei credergli o posso andare a pregare sulla tomba di Charles Manson direttamente?

dr_julius
Inviato: 20/8/2007 15:05  Aggiornato: 20/8/2007 15:16
Dubito ormai di tutto
Iscritto: 11/8/2006
Da:
Inviati: 1637
 Re: Gli anelli mancanti continuano ad aumentare
-citazione-
le proteine, allo stato attuale delle nostre conoscenze, possono essere create SOLO all'interno delle cellule; in chimica, per costruire una molecola, occorre seguire dei passaggi... al di fuori dell'ambiente cellulare nessuna proteina può essere fabbricata.

Ne sei proprio sicuro?
Mi risultano esistere processi, anche industriali, di fabbricazione delle proteine, ed essere noti da decenni processi anche NON enzimatici in fase solida. (es.: nel 1962 quello che prende il nome di Merrifield, questo è uno schema semplificato, che è valso il premio Nobel nel 1984, e che ha aperto la branca della chimica combinatoriale)

Le "conseguenze" che trai da quella premessa che ho citato andrebbero quindi rivisitate.



Sottopongo inoltre alla attenzione della discussione l'esistenza di processi autocatalitici.









EDIT: in sintesi grafica qualcuno ritiene che deve esserci qualcosa di sbagliato....

Per rifornire di elettricità un terzo dell’Italia, un’area equivalente a 15 centrali nucleari da un gigawatt, basterebbe un anello solare grande come il raccordo di Roma. (Carlo Rubbia)
Clorofilla
Inviato: 20/8/2007 15:28  Aggiornato: 20/8/2007 15:28
Mi sento vacillare
Iscritto: 6/7/2006
Da:
Inviati: 859
 Re: Gli anelli mancanti continuano ad aumentare
A parte le proteine, in vitro, grazie alla reazione a catena della Polimerasi (PCR), duplichiamo il Dna. Quindi anche senza un comparto cellulare, ma avendo un mezzo acquoso e gli elementi utili allos copo, si possono avere copie del Dna.

dr_julius
Inviato: 20/8/2007 16:06  Aggiornato: 20/8/2007 16:26
Dubito ormai di tutto
Iscritto: 11/8/2006
Da:
Inviati: 1637
 Re: Gli anelli mancanti continuano ad aumentare
Eredità di Darwin

La teoria di Darwin, in senso letterale, è sicuramente superata. Nel senso che oggi sappiamo molto di più sulla genetica, sulle regole della ereditarietà, sul DNA (e le altre biomolecole) e tantissimi dettagli che Darwin NON poteva sapere, eppure ancora gli si dà ragione: prima di lui la evoluzione non esisteva, ora invece esiste (anche se le descrizioni sono diverse) e si è "costretti" a trovare modelli che ne spieghino i meccanismi. E' questa la sua prima grandezza nella storia della Scienza.

La sua seconda enorme importanza nella Scienza và invece aldilà delle Scienze Naturali, mi sembra sia stata una vera rivoluzione che ha, per prima, dato un verso al fattore tempo.
Cerco di spiegarmi meglio: nelle discipline classiche della scienza, alle conoscenze di allora, il tempo era un fattore immutevole, praticamente eterno: era il tempo delle scienze esatte.
Da Darwin in poi, il tempo ha invece acquisito un senso: ha un verso e una direzione. Gli eventi biologici acquisiscono una specifica "unicità". Diventano "unici e irripetibili", a differenza degli eventi studiati dalla Fisica, dalla Chimica, dalla Astronomia e dalla Matematica che sono governati da Leggi che operano in un tempo immutabile.



P.S.: per chi cerca la "crezione" della vita in provetta, questi sono alcuni primi passi tricolore: Primi passi,
...mentre qui potete leggere qualcosa sull'organizzatore embrionale
P.S.2: per Massimo, cercavi una sintesi?o questa?

Per rifornire di elettricità un terzo dell’Italia, un’area equivalente a 15 centrali nucleari da un gigawatt, basterebbe un anello solare grande come il raccordo di Roma. (Carlo Rubbia)
carloooooo
Inviato: 20/8/2007 16:10  Aggiornato: 20/8/2007 16:13
Dubito ormai di tutto
Iscritto: 9/7/2006
Da: marca gioiosa et amorosa
Inviati: 1386
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
E' come dimostrare la non esistenza di Dio. Non ha senso.


Ci parli tu poi con Shevek quando passa di qua?

Ciao

astro
Inviato: 20/8/2007 16:20  Aggiornato: 20/8/2007 16:20
Ho qualche dubbio
Iscritto: 3/6/2006
Da:
Inviati: 233
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Esaminiamo ora "Proteine sinistrorse".

Anche qui parte da un premessa fallace. Poiché le proteine in natura sono formate solo da levogiri,


Mi pareva d'averlo già scritto, i 20 aa canonici non sono tutti levogiri (nel senso che ruotano la luce polarizzata in senso antiorario). Sono in conformazione L secondo una vecchia convenzione che viene mantenuta in biochimica per comodità. Se si usasse la convenzione usata invece in chimica avremmo 20 aminoacidi sia in conformazione R sia in conformazione S sia (+) sia (-).

Se vogliamo approfondire parlando della stericità del legame peptidico...

olah
Inviato: 20/8/2007 16:32  Aggiornato: 20/8/2007 17:36
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
1) le proteine, allo stato attuale delle nostre conoscenze, possono essere create SOLO all'interno delle cellule; in chimica, per costruire una molecola, occorre seguire dei passaggi... al di fuori dell'ambiente cellulare nessuna proteina può essere fabbricata.


Falso, alcune le proteine possono essere sintetizzate chimicamente.

Citazione:
Da ciò ne consegue che la probabilità di fabbricare una proteina "casualmente" é 0 (zero). L'evento é impossibile adesso come 1 milione o un miliardo di anni fa.


Qui fai altri due assunti arbitrari. Il primo è che Sicuro che spontaneo = casuale? La selezione naturale non è casuale. Il secondo è che se una cosa non la possiamo fare noi allora è impossibile, mentre sono stati già fatti esempi di architetture complesse fuori dalla nostra portata ma prodotte da processi spontanei.

Citazione:
D'altronde gli scienziati ridacchiano quando pensano che nel Medioevo ritenessero che le mosche nascessero dalla Terra. Salvo poi dire che la vita ha avuto origine proprio in quel modo tato tanto tempo fa...


Altro assunto sbagliato. Se io dico "una farfalla batte le ali a Pechino e nevica a New York" non sostengo che le farfalle facciano nevicare, ma che ci può essere una lunga concatenazione di cause ed effetti che può legare un evento a un altro. Se dico che gli atomi di carbonio di cui siamo fatti una volta appartenevano all'aria, alla terra, alle stelle (perché noi ci rigeneriamo continuamente con atomi e molecole che arrivano dall'esterno), non sostengo che l'aria, la terra e le stelle si trasformano in persone, messa così si lascerebbe intendere un passaggio diretto che non c'è. Quali sarebbero questi scienziati che parlano della terra che si trasforma in mosche? Io non ne conosco.

Citazione:
Io per esempio sono anni che cerco di spiegare che il caso non é una "causa" scientifica, per cui l'evoluzionismo non é una teoria scientifica, finora senza successo.


Non mi stupisce. C'è invece chi riesce a pubblicare i propri lavori sostenendo il contrario.

Sal
Inviato: 20/8/2007 19:57  Aggiornato: 20/8/2007 21:06
Ho qualche dubbio
Iscritto: 11/3/2007
Da:
Inviati: 80
 Re: Gli anelli mancanti continuano ad aumentare
>Io trovo particolarmente interessante, a sua volta, che queste geometrie "naturali" siano TUTTE basate sullo stesso rapporto di 1,66

Il numero aureo a cui si fa riferimento è 1,618 e non 1,66.
Mazzucco, saresti molto più credibile se non fossi quasi sempre così impreciso e raffazzonato in ciò che scrivi.

>Sull’altro fronte, ricordo un folgorante racconto di fantascienza (Asimov? Richardson?), nel quale gli umani si ingegnano per unire tutti i calcolatori della Terra, al fine di porre la Domanda Suprema: “Dio esiste?”
E la risposta fu: “Ora sì”.

Fredric Brown, "La risposta" ("Answer"), 1954.
EDIT: sto leggendo la discussione e rispondo mano a mano: vedo adesso che già altri hanno ricordato il racconto. Ne approfitto comunque per consigliare anche la lettura di "L'ultima domanda" ("The last question"), 1956, di Isaac Asimov. Occhio però che è e resta fantascienza, non scienza: lo specifico perché mi sembra che qui le due cose vengano confuse un poco troppo spesso.

>Tu infine dici che la "semplicistica teoria lineare è buona per spiegare darwin ai bambini". Il problema è che l'altra io non riesco a trovarla da nessuna parte.

È un problema tuo Mazzucco, non della teoria dell'evoluzione. Datti da fare e informati per bene prima di pontificare su tutto e di più.

Anonimo
Inviato: 20/8/2007 19:58  Aggiornato: 20/8/2007 19:58
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Mi pareva d'averlo già scritto, i 20 aa canonici non sono tutti levogiri (nel senso che ruotano la luce polarizzata in senso antiorario). Sono in conformazione L secondo una vecchia convenzione che viene mantenuta in biochimica per comodità.


Naturalmente mi riferivo alla convenzione biochimica, che è quella a cui si attaccava il turco.

Comunque sì, sempre disposto agli approfondimenti.

nottrz
Inviato: 20/8/2007 20:28  Aggiornato: 20/8/2007 20:28
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Davide71:
Citazione:

Lasciami n po' di tempo per leggerlo. Peraltro io non sostengo la teoria creazionista. Neanche quella é una teoria scientifica; la volontà divina é altrettanto antiscientifica del caso. Anzi in realtà sono due termini che esprimono lo stesso concetto con due punti di vista diversi.


Penso sia solo questione di intendersi sui termini. Nella maggior parte dei contesti che conosco il termine "caso" non viene usato in senso assoluto cosi' come avviene nell'uso quotidiano.
Quando dico che il lancio di un dado produce un risultato casuale intendo solo dire che le cause fisiche che portano al risultato finale sono talmente complesse da poterle considerare sempre slegate dal contesto in cui utilizzero' il risultato.
Un modo per ottenere un numero casuale da 1 a 12 e' bloccare una persona per strada e chidergli in che mese e' nato. E' chiaro che la sua risposta non e' data a caso e tantomeno lo e' la sua nascita in quel preciso mese. Pero' se uso il risultato per sorteggiare qualcuno tra i miei 12 amici allora lo posso considerare casuale (lasciando da parte il fatto che la distribuzione delle nascite non sia uniforme).
In questo senso il caso e' perfettamente deterministico.
Tutta la scienza si basa sul poter associare delle cause a delle conseguenze. Se si rinunciasse a questa possibilita' verrebbe giu' tutto quanto.

I rarissimi casi in cui si parla di caso in senso stretto, ovvero irrazionalita' pura, assenza di causa, sono sempre circoscritti e si tratta di "interpretazioni": ci si trova di fronte a fenomeni talmente "incomprensibili" e si _decide_ di considerarli privi di cause.
Tra l'altro spesso questo "puro caso" e' comunque vincolato da regole macroscopiche: non so quale sara' il prossimo evento che si verifichera' ma so che presi tutti assieme rispettaranno una ben precisa regola (es. il dacadimento radioattivo).


Massimo (Redazione):
Citazione:

Per quel che mi riguarda, io ho posto - e credo altri con me - una domanda basata sul buon senso, e non mi basta certo sentirmi dire che "il turco sbaglia metodo" per convincermi dell'invalidità della mia domanda.


Secondo me bisogna decidere se ci si basa sul buon senso o su strumenti condivisi. Sappiamo tutti che sono facili da costruire delle illusioni ottiche in grado di ingannare chiunque, ma che un semplice righello puo' chiarire.
Il concetto di milione di anni o quello di 10 alla 23 credo sia semplicemente ingestibile dal "buon senso". Non ne abbiamo esperienza, quindi il nostro intuito, nato dal quotidiano, si trova in difficolta'.
Se a questo punto si sceglie di usare uno strumento lo si deve pero' usare nel modo giusto: non posso decidere di usare un cannocchiale ma poi guardarci dentro dal lato sbagliato. Ovviamente mi riferisco al calcolo delle probabilita'.
E lo stesso per la chimica: se accetto che gli amminoacidi sono 120 devo anche accettare, dalla stessa fonte, che quelli chaive sono solamente 10 e cosi' via.

Gli organismi sono "cose" molto complesse? Tutti concordiamo sulla risposta affermativa, anche se ci sarebbe molto da discutere sul significato dalla parola "complesso" (un fiume e' meno complesso?).
Gli organismi sono "cose" perfette/a spanne, fragili/robusti, ecc.? La risposta a queste domande e' ancora piu' difficile da dare e il nostro buon senso si fa molto guidare da intuizioni di questo tipo.
Bisognerebbe insomma andarci un po' cauti...

Pausania:
Citazione:

Infatti non mi riferivo a te, che hai detto che l'evoluzione esiste ma che non c'è alcuna dimostrazione scientifica che spieghi la nascita della vita (cosa che qualunque scienziato direbbe, tra l'altro).


Il concetto di "dimostrazione scientifica" non penso lo userebbe nessuno scienziato. Esistono gli esperimenti ed esistono le teorie (riccamente intrecciati in "strani anelli"). Si puo' dire che un processo e' in linea di principio possibile anche se non si e' in grado di produrlo. Si puo' produrre qualcosa senza saperlo spiegare.
Se domani qualcuno andasse in laboratorio e ricreasse una cellula ci sarebbe da capire che valore avrebbe quell'esperimento riferito ai fatti successi n milioni di anni fa. Si potrebbe dire: ok, con la tecnologia di oggi si puo' fare, ma non e' stato un processo "naturale" quindi non dimostra nulla.
Oppure si potrebbe anche stimare in modo preciso che per la formazione "naturale" della prima cellula servono magari dai 10 ai 100 milioni di anni, escludendo quindi di fatto ogni possibilita' di riprodurre il fenomeno.
Si potrebbero cercare in natura i semilavorati, ma di nuovo si potrebbe sostenere che questi sono prodotti dall'attivita' degli organismi viventi e non si sono formati spontaneamente.
Insomma, il gioco delle critiche e' facile, anche perche' qui si vuole indagare su un fatto specifico, la comparsa della vita sulla Terra, e non su un fenomeno generico.
La caduta di un grave la posso sperimentare facilmente. Ma spiegare a posteriori la caduta di un particolare grave avvenuta 1 anno fa senza che fossero presenti strumenti di misurazione specifici e' quasi impossibile. Le leggi di newton le accettiamo per motivi vari, magari troviamo che ci sia una buona somiglianza tra i nostri pochi ricordi/indizi e quanto previsto e ci accontentiamo di quelle come spiegazione. Ma non si e' "dimostrato" nulla (persino la matematica ha i suoi problemi con le dimostrazioni...).

Nelle simulazioni artificiali la vita viene riprodotta in diversi modi a diversi livelli (tutti cmq piuttosto grezzi). Pero' questo tipo di sperimentazione ci dice ancora meno sul caso biologico specifico.

Un'altro grosso problema e': che cosa e' la vita? Finora abbiamo fatta finta di niente, ma non e' un aspetto secondario.
Un virus e' vivo? Un ciclo autocatalitico e' vivo? Un gruppo di proteine che "collabora" e' vivo? E' necessaria la capacita' di riprodursi per parlare di vita? Si puo' collocare una linea netta che separi i viventi dal resto?


dr_julius:
Citazione:

Da Darwin in poi, il tempo ha invece acquisito un senso: ha un verso e una direzione. Gli eventi biologici acquisiscono una specifica "unicità". Diventano "unici e irripetibili", a differenza degli eventi studiati dalla Fisica, dalla Chimica, dalla Astronomia e dalla Matematica che sono governati da Leggi che operano in un tempo immutabile.


Che io sappia in fisica il concetto di "freccia del tempo" compare con la termodinamica e penso che anche la chimica di suo avesse chiara la differenza tra processi reversibili e irreversibili. Non mi metto a cercare date e riferimenti, ma non penso sia un'idea che sia stata ricavata direttamente da Darwin.


Sal:
Citazione:

Il numero aureo a cui si fa riferimento è 1,618 e non 1,66.


Il numero aureo e' (1+radq(5))/2 ovvero _circa_ 1,618033. Insomma, non e' tanto per pedanteria che ho voluto scrivere questa cosa, ma solo perche' tutti qui parliamo un po' a spanne. A volte il senso complessivo del messaggio e' piu' importante del terzo decimale...

Sal
Inviato: 20/8/2007 21:25  Aggiornato: 21/8/2007 12:42
Ho qualche dubbio
Iscritto: 11/3/2007
Da:
Inviati: 80
 Re: Gli anelli mancanti continuano ad aumentare
>Io non faccio il chimico, e non è a me che devi dare certe spiegazioni tecniche. Se tu ritieni che quanto dici sia sufficiente a confutare per intero le critiche all'evoluzionismo che ho postato più sopra, ben per te.

Ma non ho capito: tu ti fai delle domande per imparare e trovare le risposte, o solo così, per il dubbio gusto di fare il bastian contrario?


>A me è piaciuto molto l'esempio dei mattoni e delle case, ma sperare che possa comprenderlo chi ragiona "con mente scientifica" - visto che è proprio quel modo di ragionare che vuole criticare - è una pura illusione.

L'esempio dei mattoni ti sarà pure piaciuto ma dovresti anche accettare che chi ha una mente scientifica capisce, al contrario tuo, che non è pertinente, visto che i mattoni non si riproducono come invece avviene per i composti chimici che stanno alla base della vita.


>Un pò come Attivissimo, che cerca di farti discutere sui centimetri del buco nel Pentagono, quando abbiamo ai comandi dell'aereo un imbranato totale che non sa nemmeno come funziona un'automobile, non parla una parola di inglese, e non ha mai guidato prima un jet nella sua vita.
Sorry, the big picture FIRST.

D'accordo avere dubbi sulla versione uficiale, ma estremizzare le cose fino a racontare fandonie non ti aiuterà certo nella tua crociata. E poi basta con questo Attivissimo, ma sei proprio fissato che lo tiri sempre in ballo.
Chiusa la parentesi, comunque, probabilmente quello che non riesci a capire della scienza è il suo metodo: dai dettagli si formano teorie generali e non viceversa. Tu invece vorresti una teoria generale che spiega tutto così, dal niente e poi chi se ne frega se nessun detaglio torna, basta che la teoria generale ti stia simpatica: rassegnati, questa non è scienza e non è certo con tali pretese che si delegittima la scienza.

Sal
Inviato: 20/8/2007 21:48  Aggiornato: 20/8/2007 21:50
Ho qualche dubbio
Iscritto: 11/3/2007
Da:
Inviati: 80
 Re: Gli anelli mancanti continuano ad aumentare
>Il numero aureo e' (1+radq(5))/2 ovvero _circa_ 1,618033. Insomma, non e' tanto per pedanteria che ho voluto scrivere questa cosa, ma solo perche' tutti qui parliamo un po' a spanne. A volte il senso complessivo del messaggio e' piu' importante del terzo decimale...

Se vogliamo fare a gara di pedanteria , con me non c'è storia: numero aureo, se vogliamo la precisione fino alla fine, viene definito come una delle soluzioni dell'equazione x^2 − x − 1, le cui radici sono (1±√5)/2 cioè 1,618… e - 0.618…
Avendo solo il numero positivo senso geometrico, quello è detto sezione aurea e viene di solito indicato come numero aureo "per eccellenza".

Ora, se si vuol ragionare e scrivere a spanne perché non si ha niente di meglio da fare, e si vuole cazzeggiare un po', benissimo: ma se si cerca, come fa Mazzucco, di mettere in dubbio praticamente tutta la scienza e la storia moderne, si dovrebbe essere molto più precisi nei propri discorsi e soprattutto si dovrebbe conoscere fin nei minimi particolari ciò che si ha la presunzione di criticare, e non fare minestroni di tutto un po' e per di più appunto, a spanne.

Tubo
Inviato: 20/8/2007 22:14  Aggiornato: 20/8/2007 22:14
Dubito ormai di tutto
Iscritto: 16/6/2006
Da:
Inviati: 1663
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
>Un pò come Attivissimo, che cerca di farti discutere sui centimetri del buco nel Pentagono, quando abbiamo ai comandi dell'aereo un imbranato totale che non sa nemmeno come funziona un'automobile, non parla una parola di inglese, e non ha mai guidato prima un jet nella sua vita.


Oltre a questo, che è tendenzioso e frutto di disinformazione:

Citazione:
non ha mai guidato prima un jet nella sua vita


Non vedo cosa c'entri il non saper guidare un'auto o non saper parlar una parola d'inglese.

Complimenti vivissimi!

nottrz
Inviato: 20/8/2007 23:09  Aggiornato: 20/8/2007 23:09
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Se vogliamo fare a gara di pedanteria , con me non c'è storia:


Non ti preoccupare, non ci tengo a vincere un gara di questo tipo.

Trovo solo singolare che in un post in cui si critica qualcuno per la sua imprecisione si riportino informazioni altrettanto imprecise...

Tutti hanno conoscenze limitate. Chi decide chi puo' parlare di un argomento e chi no? Istituiamo una commissione apposta? Mettiamo ai voti?
E questo vale per tutti anche nel proprio specifico campo di specializzazione (se non ce ne si rende conto allora forse serve studiare ancora un po').

A scanso di equivoci: non sto mettendo in dubbio la tua competenza personale, che certamente non conosco e non ho motivo di contestare, ma l'illusione che si possa tracciare una divisione tra chi ha diritto di parola e chi no.
Per quello ci sono, forse, le accademie, non certo i forum pubblici.


Scusate l'OT.

Redazione
Inviato: 21/8/2007 2:24  Aggiornato: 21/8/2007 2:32
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
Caro Sal: un intervento come il tuo meriterebbe una risposta molto più breve di questa, e se mi dilungo un pochino lo faccio per gli altri, che sono stati tutti interlocutori squisiti..

Capisco d’altronde il tuo pessimo umore: il fatto che un incompetente qualunque, che non sa NEMMENO quale sia l’esatto numero aureo, abbia portato altri ad ammettere che la teoria evoluzionistica (intesa come giustificazione della vita sulla terra) non esiste da nessuna parte, può dare un certo fastidio.

Con una piccola correzione solamente: il problema, in quel caso, non è il mio – come dici tu - ma il tuo (infatti chi si incazza, guarda caso, sei tu e non io), e di tutti coloro che si ergono così arrogantemente a rappresentanti della “scienza”, e poi non hanno una mezza pippa di risposta da dare a chi pone umilmente domande semplici e del tutto legittime.

Quando io – ignorante zoticone - osservo una balena, e poi la confronto con la rozzaggine di un sommergibile, mi rendo conto che il Caso è stato molto più bravo di te e di me e di tutta l’umanità messi insieme.

Quando osservo un occhio umano, e poi lo confronto con la rozzezza brutale di una macchina fotografica, provo sincera pietà per l’arroganza della scienza moderna, e di chi se ne riempie la bocca come se fosse il più sacro e intoccabile dei mantra.

Quando osservo un uccello volare, e lo confronto con la rozzezza infinita, inammissibile, addirittura imbarazzante, di un aereo qualunque – pensa, milioni di ettolitri di kerosene per imitare malamente quello che riesci a mandare avanti con qualche chicco di grano - mi vengono pietà e tristezza insieme nel ricordo del povero Leonardo (che peraltro io cito come risultato eccelso del famoso “caso”), il quale armamentava con ridicoli aggeggi assolutamente inutili per cercare di staccarsi di mezzo metro da terra.

Pensa, Sal: il tuo “caso” - quello che ha messo lì lo stagno primordiale e poi è andato al bar ad aspettare - ha saputo fare Leonardo senza il minimo sforzo, mentre Leonardo suda sette camicie, ma non riesce nemmeno a imitare l’uccello che gli caca regolarmente in testa ogni giorno.

Però tu sai qual è l’esatto numero aureo. Vuoi mettere, il vantaggio che hai? Tu sì che sei un Essere Superiore.

Redazione
Inviato: 21/8/2007 2:36  Aggiornato: 21/8/2007 2:37
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
TUBO: Non ho scritto che Hanjour "non sapeva guidare un auto", ma che non sapeva nemmeno come funzionasse. Si presume quindi che di aerodinamica, e di meccanica in generale, ne sapesse meno del mio cane ubriaco.

Inoltre, sapere l'inglese è assolutamente indispensabile per passare gli esami necessari ad ottenere la famosa licenza che secondo la Commissione 9/11 Hanjour aveva ottenuto.

Ecco "cosa c'entrano" le due cose.

Prima di accusare altri di disinformazione, informati magari tu un pò meglio.

olah
Inviato: 21/8/2007 9:46  Aggiornato: 21/8/2007 9:46
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
I rarissimi casi in cui si parla di caso in senso stretto, ovvero irrazionalita' pura, assenza di causa, sono sempre circoscritti e si tratta di "interpretazioni": ci si trova di fronte a fenomeni talmente "incomprensibili" e si _decide_ di considerarli privi di cause.


Qualcuno ha letto la saga delle fondazioni di Asimov? Brillanti matematici prevedevano il futuro di migliaia di anni grazie alle equazioni della psicostoria. Grande Asimov, sapeva che facciamo intervenire il caso per rattoppare i nostri limiti.

Concordo nottrz, il caso è un'illusione. Quanto è difficile scrivere algoritmi per generare sequenze casuali! A meno di usare algoritmi quantistici..., ma anche questa è un'altra storia...

olah
Inviato: 21/8/2007 10:02  Aggiornato: 21/8/2007 10:02
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Si puo' collocare una linea netta che separi i viventi dal resto?


Molto difficile, ci sono troppi organismi border-line. La clamidia è un batterio parassita, ma è vivente? Ci potrebbero essere discussioni infinite solo su questo argomento.

Anonimo
Inviato: 21/8/2007 11:28  Aggiornato: 21/8/2007 11:28
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Capisco d’altronde il tuo pessimo umore: il fatto che un incompetente qualunque, che non sa NEMMENO quale sia l’esatto numero aureo, abbia portato altri ad ammettere che la teoria evoluzionistica (intesa come giustificazione della vita sulla terra) non esiste da nessuna parte, può dare un certo fastidio.


Ancora? Ma chi ha amesso questo? E poi "portato" da te addirittura?

Allora mi adeguo e faccio come fai tu:

Ti ho scritto un commento smontando TUTTO il discorso del turco, e ti ho fatto una domanda. Sto ancora aspettando una risposta.


Mi pareva che un passo avanti lo avevamo fatto...

dr_julius
Inviato: 21/8/2007 11:33  Aggiornato: 21/8/2007 11:33
Dubito ormai di tutto
Iscritto: 11/8/2006
Da:
Inviati: 1637
 Re: Gli anelli mancanti continuano ad aumentare
Massimo, guarda che Morfeo ha ragione...

Con tale atteggiamento dove vuoi arrivare? vuoi spegnere la discussione?!?


Per rifornire di elettricità un terzo dell’Italia, un’area equivalente a 15 centrali nucleari da un gigawatt, basterebbe un anello solare grande come il raccordo di Roma. (Carlo Rubbia)
astro
Inviato: 21/8/2007 11:47  Aggiornato: 21/8/2007 11:47
Ho qualche dubbio
Iscritto: 3/6/2006
Da:
Inviati: 233
 Re: Gli anelli mancanti continuano ad aumentare
Morfeo, dr_julius: non vi ostinate. Ammettetelo anche voi.

Io ad esempio mi sono convertito da quando è stata pubblicato questo articolo.

Ora credo nel creatore e, in verità vi dico, Egli fa il regista.

Sal
Inviato: 21/8/2007 12:31  Aggiornato: 21/8/2007 12:42
Ho qualche dubbio
Iscritto: 11/3/2007
Da:
Inviati: 80
 Re: Gli anelli mancanti continuano ad aumentare
>Trovo solo singolare che in un post in cui si critica qualcuno per la sua imprecisione si riportino informazioni altrettanto imprecise...

Perché imprecise? Ti ricordo che la sezione aurea è un numero irrazionale: che pretendevi, un numero infinito di decimali, per essere precisi? Solitamente essa è espressa come 1,618 così come "pi greco" è espresso come 3,14, precisione che è più che sufficiente nella stragrande maggioranza dei casi.



>Chi decide chi puo' parlare di un argomento e chi no? Istituiamo una commissione apposta? Mettiamo ai voti?

Mai detto che qualcuno può parlare e altri no. Ho detto che se una persona pretende di mettere in discussione la scienza e la storia, dovrebbe come minimo farlo in maniera adeguata e informata, non scrivendo cose alla carlona: la serietà si vede nei dettagli. Naturalmente ognuno può scrivere cosa gli pare su ciò che gli pare, ma quanto sarà preso sul serio se dimostra di conoscere molto superficialmente gli argomenti che pretende di trattare in modo approfondito?

Timor
Inviato: 21/8/2007 12:55  Aggiornato: 21/8/2007 12:55
Mi sento vacillare
Iscritto: 14/11/2005
Da:
Inviati: 639
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Ora credo nel creatore e, in verità vi dico, Egli fa il regista.


Astro hai il dono inconsapevole della verità!!

Peccato che lui non lo sappia ancora

"Il vero Big Bang è la nascita di una coscienza"

"Visita Interiora Terrae Rectificando Invenies Occultum Lapidem"
nottrz
Inviato: 21/8/2007 13:52  Aggiornato: 21/8/2007 13:52
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:

Capisco d’altronde il tuo pessimo umore: il fatto che un incompetente qualunque, che non sa NEMMENO quale sia l’esatto numero aureo, abbia portato altri ad ammettere che la teoria evoluzionistica (intesa come giustificazione della vita sulla terra) non esiste da nessuna parte, può dare un certo fastidio.


Condivido quanto detto dagli altri su questo passaggio.
Secondo alcuni, e in parte condivido, l'evoluzionismo non si occupa della comparsa della vita sulla terra. In quel caso il tuo discorso cadrebbe immediatamente. Nemmeno la matematica si occupa di questo tema, ma non mi sembra si possa considerarla "falsa" per questo.
Secondo altri, io tra questi, e' possibile "estendere" l'evoluzionismo utilizzando gli stessi principi per spiegare anche la comparsa della vita.
E sono state segnalate ricerche in questo senso.

La distinzione tra teoria e ricerca e' un'altro di quei limiti sfumati. Quando si passa da una all'altra? Quando una teoria si puo' considerare accettata? Altro tema su cui discutere per ore.
Quindi si tratta solo di capire se secondo il tuo personalissimo e rispettabilissimo standard quelle ricerche siano significative o meno.

Secondo tema: gli "evoluzionisti" (che, come i "complottisti", non sono dei cloni ma delle persone con le loro personali opinioni ed e' quindi legittimo che non concordino su tutti gli aspetti) hanno serenamente ammesso che la sequenza evolutiva molto dettagliata che porta dalle prime molecole a Leonardo non e' ancora stata ricostruita.
In vario dettaglio e' pero' disponibile su molti libri, da quelli delle elementari alle pubblicazioni sulle rivista specializzate.
Il tuo standard in questo caso e' incredibilmente alto e ti permette di rifiutare in blocco la risposta. Come dicevo pero' con pretese simili sarebbe possibile mettere in ginocchio qualunque altro ramo di ricerca sui quali invece mi sembra tu non abbia gli stessi dubbi.

E anche qui di nuovo si e' mescolato il tema della comparsa della vita con quello dell'evoluzione della specie sul quale dici di non avere grossi dubbi.
Ma allora qual'e' il passaggio critico? Quello da piccole molecole a organismi unicellulari? O anche da unicellulare a pluricellulare? Da li' in poi va tutto liscio o ci sono degli altri passaggi specifici da chiarire?

Quindi dire che hai parlato con numerosi "evoluzionisti" e nessuno di loro e' stato in grado di rispondere alle tue domande non e' corretto. In realta' ti sono state fornite delle risposte, ma che tu, legittimamente, non hai ritenuto adeguate.

Citazione:

Quando osservo un occhio umano, e poi lo confronto con la rozzezza brutale di una macchina fotografica, provo sincera pietà per l’arroganza della scienza moderna, e di chi se ne riempie la bocca come se fosse il più sacro e intoccabile dei mantra.


Io in realta' un occhio umano e una macchina fotografica non li trovo cosi' diversi. Il confronto invece tra uccelli e aerei e libellule ed elicotteri invece li trovo piu' significativi. Anche se andrebbe tenuto conto che un uccello deve sollevare solo pochi grammi, mentre un aereo qualche tonnellata.
Il confronto andrebbe fatto con un aereo telecomandato di ultimissima genarazione (carbonio, ec.). Penso che anche in quel caso l'uccello vincerebbe, pero' il confronto sarebbe piu' onesto.


olah:
Citazione:

Molto difficile, ci sono troppi organismi border-line. La clamidia è un batterio parassita, ma è vivente? Ci potrebbero essere discussioni infinite solo su questo argomento.


Condivido. Secondo alcune definizioni la vita verrebbe creata quotidianamente in molte simulazioni artificiali. Secondo altre le citta' si possono considerare come entita' viventi (simili a muffe o piante, sarebbe da capire).


Sal:
Citazione:

Il numero aureo a cui si fa riferimento è 1,618 e non 1,66.


Penso converrai con me che la frase qui sopra e' falsa. Non e' questione di precisione adeguta o meno per eventuali calcoli.
Sarebbe bastato aggiungere un "circa" per renderla vera.
Non avrei mai contestato una cosa simile se non per mostrare che tutti scriviamo in modo piu' o meno impreciso. E visto che si sostiene che "la serietà si vede nei dettagli" lo vedevo utile come spunto di riflessione su cosa si possa considerare precisione e cosa no e sul fatto che il limite tra precisione e imprecisione sia sfumato/intrecciato/arbitrario e dipenda dal contesto.

Clorofilla
Inviato: 21/8/2007 14:18  Aggiornato: 21/8/2007 14:18
Mi sento vacillare
Iscritto: 6/7/2006
Da:
Inviati: 859
 Re: Gli anelli mancanti continuano ad aumentare
Sempre dalle Scienze di Agosto c'è un altro articolo interessante. Riguarda la scoperta di strutture simili a quelle che abbiamo nelle sinapsi.
Il che ribalta un pò le consocenze sulle cellule di questi organismi "primitivi".
Inoltre già si sapeva da alcuni anni di molecole nelle spugne che assomigliano a quelle che entrano in azione nei trapianti per il riconoscimento cellulare.

In sostanza il succo dell'articolo parla dei geni e del genoma e dei loro prodotti molecolari. Il gene sintetizza il suo prodotto, il quale prodotto può essere utilizzato per produrre anche più strutture biologiche o strutture diverse da organismo a organismo. Non esistono geni specifici che fanno gambe o antenne. Cambierebbe in un certo senso la regia che dirige il prodotto dei geni.

nottrz
Inviato: 21/8/2007 14:25  Aggiornato: 21/8/2007 14:25
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Una risposta "evoluzionistica" alla domanda sulla comparsa della vita.

http://www.talkorigins.org/faqs/abioprob/originoflife.html

Tubo
Inviato: 21/8/2007 15:51  Aggiornato: 21/8/2007 15:51
Dubito ormai di tutto
Iscritto: 16/6/2006
Da:
Inviati: 1663
 Re: Gli anelli mancanti continuano ad aumentare
Ciao Massimo,
non continuo qui perchè la discussione è interessante e il mio post sarebbe OT, dico solo che naturalmente avere conoscenze aeronautiche e parlare bene l'inglese sono requisiti indispensabili per pilotare aeroplani, soprattutto di linea, ma che Hanjour non avesse la licenza FAA non è vero, che parlasse poco inglese e non conoscesse il funzionamento di un'automobile non inficia il fatto che egli abbia potuto pilotare il 757 contro un edificio dato che l'aereo era già in volo e non doveva atterrare.
Al cospiratore sarebbe bastato fornire al posto di quello di Hanjour un nominativo più accreditato del dirottatore di AA77 e la questione pilota impreparato e incapace sarebbe morta in partenza.

Sto dicendo che il dramma della dinamica dell'impatto al Pentagono non risiede nella reale o presunta capacità di esecuzione del volo nè nel buco troppo piccolo (?) ma nel fatto che nessun video mostra niente e mai probabilmente ne verrà rilasciato uno chiarificatore.

Ciao e scusate il breve OT, non lo faccio più!

Sal
Inviato: 21/8/2007 15:58  Aggiornato: 22/8/2007 10:24
Ho qualche dubbio
Iscritto: 11/3/2007
Da:
Inviati: 80
 Re: Gli anelli mancanti continuano ad aumentare
>Capisco d’altronde il tuo pessimo umore: il fatto che un incompetente qualunque, che non sa NEMMENO quale sia l’esatto numero aureo, abbia portato altri ad ammettere che la teoria evoluzionistica (intesa come giustificazione della vita sulla terra) non esiste da nessuna parte, può dare un certo fastidio.

Dove sarebbe successo questo? No, perché io non me ne sono accorto. Quello che ho letto io sono molti commenti e articoli che di giustificazioni ne danno, eccome, e pure ben articolate e convincenti: fatto salvo che tu puoi non concordare, non ho visto un tuo commento (che sia uno) in risposta diretta a tutto ciò e in cui tu spieghi nei dettagli, entrando nel merito, quali siano le tue critiche mirate ai commenti e articoli suddetti.
Ti limiti a ripetere con cieca ostinazione le tue due formulette probabilistiche, ampiamente sbugiardate, e arrivi a pretendere che ti si descriva minuziosamente, passo passo, secondo per secondo, come si arriva dalla materia inanimata a Leonardo da Vinci, pena l'invalidamento di tutte, proprio tutte le teorie evoluzionistiche: questo dopo aver detto che bisogna guardare al quadro generale e non al particolare. Ora d'accordo fare i bastian contrari, ma almeno con te stesso puoi metterti d'accordo e dimostrare almeno una parvenza di coerenza?
Già che ci siamo, visto che sei maestro di retorica e di fallaciae, tanto da aver dedicato una pagina ad esse e da usarne e abusarne spesso e volentieri, come si chiama la fallacia che stai usando tu, cioè quella per cui "se una teoria non spiega assolutamente tutto in ogni più minimo particolare, allora è del tutto sballata, anche nelle parti che spiega egregiamente"? Visto la totale inconsistenza del ragionamento esposto, io la chiamerei argomentum ad canis penem.



>Con una piccola correzione solamente: il problema, in quel caso, non è il mio – come dici tu - ma il tuo (infatti chi si incazza, guarda caso, sei tu e non io), e di tutti coloro che si ergono così arrogantemente a rappresentanti della “scienza”, e poi non hanno una mezza pippa di risposta da dare a chi pone umilmente domande semplici e del tutto legittime.

Innanzitutto non mi sono incazzato. ho solo esposto le mie pacate critiche al metodo sballato che usi per giustificare le tue errate convinzioni.
Seconda cosa, se tu non capisci una teoria ciò non significa che essa sia sbagliata ma solo che tu non hai le conoscenze e/o capacità per capirla: niente di cui vergognarsi a meno che tu non ti ritenga onnisciente e che quindi tu ritenga che le tue opinioni debbano essere legge per chiunque. Nel qual caso si configurerebbe la fallacia del "Pio desiderio", sottospecie della fallacia detta "ricorso alle conseguenze di una credenza", e il problema è e resta tuo.
Terzo, tu consideri una domanda come "Spiegatemi nel più minimo dettaglio come si passa dalla materia inanimata a Leonardo da Vinci", una domanda semplice, cui basta una rispostina semplice semplice e magari di poche righe, visto che tu ammetti che di chimica, biologia e quant'altro indispensabile alla comprensione degli avvenimenti non solo non ne sai un tubo, ma neanche hai voglia di sbatterti per impararne qualcosa? Chissà quali sono le tue domande complicate, allora!!!



>Quando io – ignorante zoticone - osservo una balena, e poi la confronto con la rozzaggine di un sommergibile, mi rendo conto che il Caso è stato molto più bravo di te e di me e di tutta l’umanità messi insieme.Quando osservo un occhio umano, e poi lo confronto con la rozzezza brutale di una macchina fotografica, provo sincera pietà per l’arroganza della scienza moderna, e di chi se ne riempie la bocca come se fosse il più sacro e intoccabile dei mantra. Quando osservo un uccello volare, e lo confronto con la rozzezza infinita, inammissibile, addirittura imbarazzante, di un aereo qualunque – pensa, milioni di ettolitri di kerosene per imitare malamente quello che riesci a mandare avanti con qualche chicco di grano - mi vengono pietà e tristezza insieme nel ricordo del povero Leonardo (che peraltro io cito come risultato eccelso del famoso “caso”), il quale armamentava con ridicoli aggeggi assolutamente inutili per cercare di staccarsi di mezzo metro da terra.

Io non ti ho mai apostrofato come "ignorante zoticone", ma al massimo come "facilone", che non si da la pena di informarsi in modo approfondito, o di riflettere in modo serio, prima di scrivere.
Infatti non consideri che il caso ha avuto a disposizione miliardi di anni per produrre ciò che ha prodotto (e lo ha prodotto, visto che siamo qui, su questo non ci piove), mentre il metodo scientifico esiste da solo cinquecento anni e solo cinquecento anni ha avuto a disposizione per spiegare tutto 'sto po' po' di ambaradan, oggettivamente granduccio e complicatino, che è l'universo, la vita e tutto quanto. Torniamo all'argomentum ad canis penem: visto che in cinquecento anni il metodo scientifico non ha permesso di rispondere in tutto e per tutto a tutte le domande e a tutti i particolari possibili e immaginabili con certezza assoluta, allora non solo non ci riuscirà mai ma tutto ciò che finora ha spiegato non vale un tubo.
Il tuo più grande limite non è quello di non avere neanche mezza infarinatura degli argomenti scientifici che pretendi di contestare con successo, ma è quello che non capire e non voler capire in cosa consista il metodo scientifico e quali siano gli obiettivi e le metodologie della scienza:
— la scienza non ha come obiettivo scoprire il perché ontologico delle cose, ma solo il come funzionano i vari meccanismi (per fare un esempio banale, a Newton interessava sapere quali sono le forze che governano la gravità e come calcolarle per fare delle previsioni, non perché le forze siano proprio quelle e non altre; e men che meno interessava il perché ultimo per cui la gravità esiste)
— la scienza non balza alle conclusioni per illudersi di avere certezze assolute, inventandosi conclusioni campate in aria che spiegano tutto e il contrario di tutto (del tipo "Esiste qualcuno che tutto può e tutto sa: decide lui e le sue vie sono per noi misteriose"): la scienza si "accontenta" di procedere gradualmente sulla strada del sempre più preciso, senza pretendere di rivelare chissà quali verità assolute tutte di botto. Qui e qui trovi due articoletti molto brevi e semplici sull'epistemologia della scienza e sulla relatività del torto: li ho scelti apposta molto corti e semplici come piacciono a te nella speranza che tu trovi dieci minuti per leggerli, anche se poco ci conto, visto che finora hai dimostrato di non aver mai avuto l'intenzione neanche di leggere mezza parola dei link che ti sono stati forniti.

Tra parentesi, sempre a proposito delle fallaciae che tanto ti intrigano, questa tua di attribuire alla scienza scopi e capacità che non ha, e che non vuole avere, per poi criticarla in toto basandoti su tali tue sbagliate convinzioni, è detta "descrizione dello spaventapasseri".



>Pensa, Sal: il tuo “caso” - quello che ha messo lì lo stagno primordiale e poi è andato al bar ad aspettare - ha saputo fare Leonardo senza il minimo sforzo, mentre Leonardo suda sette camicie, ma non riesce nemmeno a imitare l’uccello che gli caca regolarmente in testa ogni giorno.

Ancora l'argomentum ad canis penem, ancora la dimostrazione che manco ti sforzi di capire il punto di vista altrui ma rimani arroccato sulle tue posizioni con un paraocchi gigante ben saldato in testa. Il tuo, e te lo hanno spiegato in decine di modi diversi, è un errore di metodo:
— non conosci né minimamente ti sforzi di conoscere le cose su cui pretendi di far valere le tue opinioni come fossero legge
— dimostri ad ogni piè sospinto la tua impreparazione facendo un gran minestrone di tutto, confondendo argomenti che nulla hanno a che fare l'uno con l'altro
— pretendi che ti si convinca di ogni minimo particolare con delle spiegazioni semplicistiche ed elementari di fenomeni molto complessi che richiedono anni di studio specialistico solo per venir minimamente compresi, mentre tu manco fai lo sforzo di leggere (neanche capire) ciò che ti viene proposto come approfondimento: ma dove sta scritto che il poco o tanto che sai deve essere sufficiente a capire tutto di tutto alla prima, e che se non capisci qualcosa tu, allora quel qualcosa deve essere per forza sbagliato?



>Però tu sai qual è l’esatto numero aureo. Vuoi mettere, il vantaggio che hai? Tu sì che sei un Essere Superiore.

No, io non sono un Essere Superiore: è il metodo che uso (mettere sempre in dubbio la mia preparazione e informarmi per bene prima di dare fiato ai denti) che è superiore al tuo, ed è un metodo che molti con me condividono, senza che nessuno si ponga per questo su un piedistallo. Certo, tu a parole sostieni di dubitare di tutto, ma quello che dimostri è non hai capito che esiste una sostanziale differenza tra "dubbio critico" e "dubbio acritico": il primo porta a farsi domande e poi cercare risposte, il secondo a fare domande fine a se stesse, non tese a far progredire la ricerca ma solo tese a fare i bastian contrari per partito preso (il che è altrettanto idiota che essere omologati e accettare tutto, sempre e solo per partito preso).
E infatti, dopo che hai posto le tue domande, non vai mai ad approfondire (ed eventualmente criticare con cognizione di causa) le indicazioni che ti vengono fornite: ti limiti invece a ripetere all'infinito le stesse domande come se questo bastasse automaticamente a dimostrare l'infondatezza di ciò su cui poni quesiti. Mazzucco, se qui c'è qualcuno che si ritiene un Essere Superiore, convinto che a lui basti esporre un dubbio per demolire qualsiasi cosa che non gli aggradi, quello mi pari proprio essere tu.


P.S.
Ancora sulle fallaciae, ti consiglio di visitare questo sito: ne sono descritte parecchie, che tu hai dimenticato di elencare qui su Luogocomune.
Forse perché ne fai abbondante uso (vedi ad esempio "avvelenamento del pozzo", "ricorso a credenze", "ricorso alle conseguenze di una credenza" e "Pio desiderio" in particolare, come esemplificato, "ricorso all'emozione", emozione negativa per negare nel tuo caso, "
onere della prova
", "descrizione del caso particolare", altrimenti detto "ipocrisia" e tante, tante altre...) Vero è che spesso e volentieri usi anche le fallaciae che stigmatizzi tu stesso qui su Luogocomune e che spesso critichi negli altri, tipo il "pendio scivoloso", il "falso dilemma" e il sempreverde "ad hominem" in tutte le sue forme e sfumature ("tu quoque", "circostanziale", "ricorso al ridicolo" e "ricorso al disprezzo")

Redazione
Inviato: 21/8/2007 18:10  Aggiornato: 21/8/2007 22:13
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
Avete ragione, nessuno ha riconosciuto che la teoria non esiste:

ASTRO - Mi chiedi come chiamare la teoria che spiega l'origine della comparsa della vita. Semplice:
non c'è una teoria scientifica che spiega la comparsa della vita. Tutto qui.

OLAH - Per quanto riguarda le teorie sulla nascita delle vita, è molto difficile dimostrare come sia avvenuta dato che non è un fenomeno riproducibile in laboratorio, almeno per il momento.

SLUMP - Secondo me invece ciò che è, anche probabilisticamente, più difficile spiegare è come si sia passati dal singolo protoorganismo unicellulare all'uomo attuale in un tempo tutto sommato non troppo lungo (500/600 milioni di anni si dice) e solo attraverso mutazioni assolutamente casuali

MORFEO: Da qui a chiedere di sviluppare un'intera teoria, con tutti i passaggi dal abiotico a Leonardo, altrimenti non possiamo dire male del turco, mi sembra alquanto esagrata come pretesa.

NOTTRZ: No, non c'e' una teoria che abbia ancora ricostruito/documentato tutti i numerosissimi micro passaggi da ameba a Leonardo.

Vado avanti? (nel senso che mi sono fermato a metà circa della rilettura).

Ragazzi, girateci intorno come volete, giocate con le parole, illudetevi che il problema sia Mazzucco, ma di qui non si scappa: voler sostenere che una cosa è avvenuta senza saper spiegare come sarebbe avvenuta è semplicemente ridicolo. Se poi è fatto con arroganza.....

(Adesso mi raccomando, ricominciate a dire che sono io che non ho capito.....)

dr_julius
Inviato: 21/8/2007 23:27  Aggiornato: 21/8/2007 23:27
Dubito ormai di tutto
Iscritto: 11/8/2006
Da:
Inviati: 1637
 Re: Gli anelli mancanti continuano ad aumentare
Randy Olson, dal Midwest, riesce a sfottere sia evoluzionisti che creazionisti.
Film: Flock of Dodos. (sito ufficiale con trailer )
Vedi uno spezzone dai toni evidenti.

Per rifornire di elettricità un terzo dell’Italia, un’area equivalente a 15 centrali nucleari da un gigawatt, basterebbe un anello solare grande come il raccordo di Roma. (Carlo Rubbia)
astro
Inviato: 22/8/2007 2:56  Aggiornato: 22/8/2007 2:56
Ho qualche dubbio
Iscritto: 3/6/2006
Da:
Inviati: 233
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
(Adesso mi raccomando, ricominciate a dire che sono io che non ho capito.....)


Dunque, prendendo spunto da un abstract (sperando che tu abbia letto l'articolo intero) dove dei ricercatori propongono un ricollocamento tassonomico dell'homo abilis, scrivi un articolo sostenendo che il neodarwinismo è una teoria che non regge.

Nel corso della discussione chiedi lumi sull'origine della vita e ti viene detto che
1) non è un aspetto compreso nella teoria evoluzionista
2) al momento non c'è un modello plausibile.


Adesso spiegaci dove in queste 6 righe ti perdi o fai finta di perderti.

Paxtibi
Inviato: 22/8/2007 3:27  Aggiornato: 22/8/2007 3:27
Sono certo di non sapere
Iscritto: 3/4/2005
Da: Atene
Inviati: 8134
 Re: Gli anelli mancanti continuano ad aumentare
Scusate se intervengo un po' a sproposito, ma ho appena letto una notizia che potrebbe essere interessante in questo contesto (se non lo fosse, ignoratela ):

'It might be life Jim...', physicists discover inorganic dust with life-like qualities

V.N. Tsytovich of the General Physics Institute, Russian Academy of Science, in Moscow, working with colleagues there and at the Max-Planck Institute for Extraterrestrial Physics in Garching, Germany and the University of Sydney, Australia, has studied the behaviour of complex mixtures of inorganic materials in a plasma. Plasma is essentially the fourth state of matter beyond solid, liquid and gas, in which electrons are torn from atoms leaving behind a miasma of charged particles.

Until now, physicists assumed that there could be little organisation in such a cloud of particles. However, Tsytovich and his colleagues demonstrated, using a computer model of molecular dynamics, that particles in a plasma can undergo self-organization as electronic charges become separated and the plasma becomes polarized. This effect results in microscopic strands of solid particles that twist into corkscrew shapes, or helical structures. These helical strands are themselves electronically charged and are attracted to each other.

Quite bizarrely, not only do these helical strands interact in a counterintuitive way in which like can attract like, but they also undergo changes that are normally associated with biological molecules, such as DNA and proteins, say the researchers. They can, for instance, divide, or bifurcate, to form two copies of the original structure. These new structures can also interact to induce changes in their neighbours and they can even evolve into yet more structures as less stable ones break down, leaving behind only the fittest structures in the plasma.

olah
Inviato: 22/8/2007 10:24  Aggiornato: 22/8/2007 10:24
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Ragazzi, girateci intorno come volete, giocate con le parole, illudetevi che il problema sia Mazzucco, ma di qui non si scappa: voler sostenere che una cosa è avvenuta senza saper spiegare come sarebbe avvenuta è semplicemente ridicolo. Se poi è fatto con arroganza.....


Non ci sono problemi nè con Mazzucco nè con le parole. Le teorie forniscono dei modelli confutabili. Quindi non è che non si forniscano spiegazioni, si forniscono spiegazioni ma con un livello di precisione e di dettaglio da affinare nel tempo. Questo vale non solo per la biologia ma anche per altre discipline.

Redazione
Inviato: 22/8/2007 11:40  Aggiornato: 22/8/2007 11:41
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
OLAH: Citazione:
si forniscono spiegazioni ma con un livello di precisione e di dettaglio da affinare nel tempo.


Benissimo, mi metto anch’io a tifare per un “affinamento” nel tempo.

Visto però che per ora questa teoria “in fieri” sta più o meno al livello della mia storiella del dinosauro che diventa ragioniere, o del puma che fa il “salto quantico”, spero vorrai concordare che è del tutto illecito cercare di trarre una qualunque conclusione da essa.

Era tutto lì quello che volevo sottolineare, e non che "allora Dio esiste".

°°°

ASTRO: Citazione:
Dunque, prendendo spunto da un abstract (sperando che tu abbia letto l'articolo intero) dove dei ricercatori propongono un ricollocamento tassonomico dell'homo abilis, scrivi un articolo sostenendo che il neodarwinismo è una teoria che non regge.

Nel corso della discussione chiedi lumi sull'origine della vita e ti viene detto che
1) non è un aspetto compreso nella teoria evoluzionista
2) al momento non c'è un modello plausibile.

Adesso spiegaci dove in queste 6 righe ti perdi o fai finta di perderti.


Non mi perdo affatto, sto benissimo dove sono, e le conclusioni a cui siamo arrivati mi vanno benissimo.

Anzi, visto che l’evoluzionismo non si occupa della comparsa della vita, cercherò di informare al più presto tutti quelli che da anni si stanno scannando all’ombra del dibattito “Evoluzionismo – Creazionismo”, e gli dirò che stanno dando cazzotti nel vuoto più assoluto. Una teoria addirittura “non esiste”, l’altra – detta come la dicono i Creazionisti - fa ridere i polli.

(Fra i due, se c’è uno che finge di non capire sei tu, caro Astro. Quante volte ho scritto che “intendo per Evoluzionismo la teoria che giustifica attraverso la sola evoluzione la presenza dell’uomo sulla terra”?)

Caronte
Inviato: 22/8/2007 12:01  Aggiornato: 22/8/2007 12:01
So tutto
Iscritto: 25/12/2005
Da:
Inviati: 14
 Re: Gli anelli mancanti continuano ad aumentare
Redazione ha scritto:

voler sostenere che una cosa è avvenuta senza saper spiegare come sarebbe avvenuta è semplicemente ridicolo. Se poi è fatto con arroganza.....


La tua è una forzatura, e lo sai benissimo. La teoria dell'evoluzione può essere criticata, rivista, perfezionata, o magari messa da parte per una teoria più convincente (vedi l'esempio delle due teorie della gravitazione di Einstain e Newton), ma che da qualche parte "là fuori" esista la spiegazione scientifica di come ciò è avvenuto, solo che l'uomo non l'ha ancora trovata, è decisamente molto più plausibile della favoletta del creatore.

Demandare il tutto ad una non ben identificata entità superiore ci mette allo stesso livello di quegli ominidi di cui stiamo trattando.


---
Se dio avesso voluto che noi credessimo in lui sarebbe esistito (Daniele Luttazzi).

Clorofilla
Inviato: 22/8/2007 12:59  Aggiornato: 22/8/2007 12:59
Mi sento vacillare
Iscritto: 6/7/2006
Da:
Inviati: 859
 Re: Gli anelli mancanti continuano ad aumentare
Diciamo che per "evoluzione" in senso stretto occorrono gli organismi e ciò che ne deriva nel tempo. Prima di arrivare ai primi organismi unicellulari potremmo forse parlare di evoluzione in senso lato o evoluzione della materia amio modo di vedere. L'abiogenesi cerca di spiegare come ciò possa essere avvenuto. Ha un pò un piede in due staffe. Fa da trait-d'union e da innesco. Dopo parliamo appunto di evoluzione vera e propria, con organismi che si replicano e mutano.

Davide71
Inviato: 22/8/2007 13:09  Aggiornato: 22/8/2007 13:09
Dubito ormai di tutto
Iscritto: 8/7/2006
Da:
Inviati: 2108
 Re: Gli anelli mancanti continuano ad aumentare
Ciao a tutti: cito da Clorofilla:

Citazione:
In sostanza il succo dell'articolo parla dei geni e del genoma e dei loro prodotti molecolari. Il gene sintetizza il suo prodotto, il quale prodotto può essere utilizzato per produrre anche più strutture biologiche o strutture diverse da organismo a organismo. Non esistono geni specifici che fanno gambe o antenne. Cambierebbe in un certo senso la regia che dirige il prodotto dei geni.


Questo significa che esiste una volontà dietro la fabbricazione delle strutture biologiche, o sbaglio.
Quindi esiste una "sfera della volontà", in cui risiede la causa delle trasformazioni biologiche. Esiste oggi come all'inizio dei tempi.

Per Morfeo: non ho mai messo in dubbio la capacità degli scienziati di replicare qualche struttura biologica, una volta conosciuta la composizione chimica. Dico solo che 4 miliardi di anni fa l'industria chimica non c'era. Per cui ritorniamo al punto di partenza: non esiste nessuna possibilità di fabbricare una proteina al di fuori dell'ambiente cellulare.
Oppure del laboratorio chimico. Per cui il discorso delle probabilità non ha ragion d'essere. Sul fatto che poi il caso é anti scientifico ci ho messo una pietra sopra. Peraltro gli scienziati dovrebbero almeno verificare la possibilità di creare la vita dalle condizioni del brodo primordiale. Lo hanno fatto e hanno verificato che ciò non é possibile. Solo che non lo vogliono ammettere...

Non date le perle ai cani e ai porci perchè non le mangeranno e vi si rivolteranno contro.
nottrz
Inviato: 22/8/2007 13:39  Aggiornato: 22/8/2007 13:39
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Visto però che per ora questa teoria “in fieri” sta più o meno al livello della mia storiella del dinosauro che diventa ragioniere, o del puma che fa il “salto quantico”, spero vorrai concordare che è del tutto illecito cercare di trarre una qualunque conclusione da essa.


Massimo, secondo me resti legato ad un straw man colossale, ovvero critichi la tua storiella.
Le critiche fatte all'evoluzionismo in questo thread mi pare siano state tutte smontate.


- calcoli probabilistici: sbagliati sotto almeno 3 punti di vista.
- mancanza di anelli intermedi: falsa
- mancanza di eventi di speciazione: falsa
- evoluzione basata solo sul caso: falso
- impossibilita' di comparsa di ordine dal caso: falso
- problemi di secondo principio della termodinamica: falso
- mancanza di teorie che spieghino la comparsa della vita: falsa


Astro puo' non essere d'accordo sul fatto che queste ultime siano catalogabili propriamente sotto l'etichetta "evoluzionismo" ma non penso neghi che esistano e che siano in qualche modo legate a questo tema.
Smith e Dawkins, giusto per citare un paio di grossi nomi, comunque mi sembrano di quest'ultimo parere.

- non esiste la teoria che spieghi i passaggi da ameba a uomo: falso
a meno che si richieda un livello di dettaglio enorme. Non sto contraddicendo ne' me ne' gli altri perche' se leggi bene tutti hanno fatto questa distinzione nei loro post (che hai evidentemente omesso).
Ci sono dei punti dove il dettaglio e' elevato. Altri dove e' minore. Guarda caso si dice che quelli meno precisi sono in realta' i piu' importanti: non e' che forse li si rende importanti proprio perche' sono i piu' facili da attaccare? Tempo fa le barzellette erano sul passaggio rettile uccello. Adesso che quello e' stato chiarito ci si sposta su quello unicellulare/pluricellulare o su quello proteina/unicellulare.
Il motivo della maggior o minor precisione dei dati e' stato anche spiegato (tempo, caratteristiche fisiche delle traccie che si dovrebbero trovare, ecc.).

A favore della teoria ci sono qualche tonnellata di fossili, gli studi sui soliti moscerini e affini, studi genetici vari e immagino altri elementi.
La teoria e' coerente, verificabile, falsificabile, ha potere predittivo.

Alcuni aspetti della teoria sono riproducibili in laboratorio, altri tramite simulazioni, altri no. Cosi' come avviene per _ogni_ teoria.

Concordi con quanto scritto qui sopra o sei in disaccordo con uno o piu' punti? Se si', perche'?
Mi sono perso qualche critica importante? Oltre alla tua personale convinzione "metafisica" che nonostante non si possano fare dei calcoli precisi la probabilita' sarebbe comunque e certamente infinitesima?

Se poi, mi sembra di capire, tu hai mille altre critiche di cui non vuoi parlare e ti basi su quelle allora e' un altro discorso.

Altrimenti non capisco piu' di cosa stiamo discutendo.

Citazione:

Quante volte ho scritto che “intendo per Evoluzionismo la teoria che giustifica attraverso la sola evoluzione la presenza dell’uomo sulla terra”


Giustifica e' una parola che mi spaventa, sa molto di metafisico. Se stiamo facendo una discussione metafisica allora non ho capito nulla.
Di solito il termine evoluzionismo viene usato in ambito biologico e non ho avuto grossi dubbi durante la discussione che quello fosse l'ambito di riferimento.
Se si usano i termini dandogli un significato diverso da quello convenzionale di sicuro si fa molta confusione.
L'evoluzionismo spiega, descrive, ricostruisce, la presenza dell'uomo.
L'uomo esiste come conseguenza delle caratteristiche fisico/chimiche del sistema Terra/Sola. Se vuoi sapere come mai le caratteristiche del sistema sono proprio quelle puoi chiederelo ad un geologo o a un astronomo, e se ancora non ti basta mi sa che devi rivolgerti alla religione o qualcosa di simile.

Clorofilla
Inviato: 22/8/2007 13:40  Aggiornato: 22/8/2007 13:40
Mi sento vacillare
Iscritto: 6/7/2006
Da:
Inviati: 859
 Re: Gli anelli mancanti continuano ad aumentare
Calmo. L'articolo non specifica nessuna "volontà" e nemmeno la scienza, almeno per ora. Nella "regia" ci dobbiamo sempre mettere l'ambiente, la selezione, geni che regolano altri geni ecc...

Il fatto che non esista nessuna possibilità di creare le proteine fuori dalla cellula è possibile ma ancora non certo.

Il fatto che ancora ci sfuggano dati non è detto che abbia fallito il brodo primordiale. La partita è ancora aperta visto che le ricerche continuano.

olah
Inviato: 22/8/2007 14:16  Aggiornato: 22/8/2007 14:16
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Visto però che per ora questa teoria “in fieri” sta più o meno al livello della mia storiella del dinosauro che diventa ragioniere, o del puma che fa il “salto quantico”, spero vorrai concordare che è del tutto illecito cercare di trarre una qualunque conclusione da essa.


Questo è il tuo pensiero, rispettabile come qualunque opinione personale, ma del tutto arbitrario. Di teorie scientifiche sull'abiogenesi e l'evoluzione ne sono state citate diverse. Se dici che sono ridicole puoi sempre provare a nominarle e confutarle dicendo dove sbagliano e perché, il che significa che prima dovresti studiarle un pochino, almeno per rispetto verso le persone che ci hanno lavorato per anni.

Quello che dici si può applicare a qualunque cosa, se avessi detto: la teoria della gravità è inconcludente, sarebbe stato uguale. Quale teoria della gravità? Newtoniana, relativistica, quantistica? Dove sbaglia?

Se queste teorie, non meglio specificate, sono al livello di una barzelletta, allora gli scienziati raccontano barzellette e non si capisce bene perché si ostinino a pubblicare i loro lavori.
Se invece gli scienziati non raccontano barzellette, allora andrebbero presi sul serio. Dato che per sostenere le loro teorie devono rispettare un minimo di rigore scientifico, anche chi confuta le loro teorie dovrebbe fare lo stesso.

nottrz
Inviato: 22/8/2007 14:22  Aggiornato: 22/8/2007 14:22
Ho qualche dubbio
Iscritto: 21/5/2006
Da:
Inviati: 74
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:

Per cui ritorniamo al punto di partenza: non esiste nessuna possibilità di fabbricare una proteina al di fuori dell'ambiente cellulare.
[...]
Lo hanno fatto e hanno verificato che ciò non é possibile. Solo che non lo vogliono ammettere...


Non possiamo dire che poiche' oggi siamo in grado di ottenere qualcosa solo con un processo complicato allora necessariamente non esistono metodi alternativi piu' semplici.

E neppure confondiamo il fatto di non riuscire a fare qualcosa con il dimostrare che quella cosa e' impossibile. Quasi sempre prima di un successo c'e' una lunga serie di fallimenti.

olah
Inviato: 22/8/2007 14:34  Aggiornato: 22/8/2007 14:34
Ho qualche dubbio
Iscritto: 26/5/2007
Da: ValSusa
Inviati: 100
 Re: Gli anelli mancanti continuano ad aumentare
Citazione:
Dico solo che 4 miliardi di anni fa l'industria chimica non c'era. Per cui ritorniamo al punto di partenza: non esiste nessuna possibilità di fabbricare una proteina al di fuori dell'ambiente cellulare.


Non c'era l'industria chimica ma c'era la chimica ed il tuo assunto è arbitrario: la sitensi proteica può avvenire fuori dalla cellula se ci sono i componenti necessari alla traduzione del mRNA, cioè in presenza dei catalizzatori e dei reagenti, anche in vitro.

Ma ammesso per assurdo che questo non fosse vero, ciò non dimostrerebbe la presenza di un fine o di una volontà. Infatti il problema non è l'ordine in cui sono apparse le cose.

Redazione
Inviato: 22/8/2007 16:44  Aggiornato: 22/8/2007 16:44
Webmaster
Iscritto: 8/3/2004
Da:
Inviati: 19594
 Re: Gli anelli mancanti continuano ad aumentare
Ragazzi, perdonatemi ma mi sono stufato di girare intorno al palo. Ormai abbiamo detto tutto e il contrario di tutto 7 volte. Alla prossima.

nessuno
Inviato: 4/9/2007 14:26  Aggiornato: 4/9/2007 14:26
Mi sento vacillare
Iscritto: 30/7/2005
Da: Albino (BG) - Bassa Valle Seriana
Inviati: 501
 Re: Gli anelli mancanti continuano ad aumentare
Qualcuno è convinto del contrario...

Da: "Il Manifesto", 2 settembre 2007

il manifesto del 02 Settembre 2007
I crociati dell'antidarwinismo alla ricerca del senso, che non c'è
Sotto un titolo eloquente, «In difesa di Darwin. Piccolo bestiario dell'antievoluzionismo all'italiana», Telmo Pievani riprende i passaggi della discussione relativa all'insegnamento della teoria dell'evoluzione nelle scuole
Giovanni Iorio Giannoli


In una serie di saggi composti tra il 2003 e il 2004, ora raccolti e tradotti in italiano con il titolo Tra scienza e fede (Laterza, 2006, pp. 292, euro 18) Jürgen Habermas ha espresso serie preoccupazioni circa la possibilità che nella cultura occidentale si riacutizzi lo scontro tra il pensiero laico e la coscienza religiosa. A detta di Habermas, una contrapposizione del genere metterebbe in crisi la stabilità politica degli Stati costituzionali, l'ethos civico già difeso da Immanuel Kant e basato sul pluralismo delle concezioni del mondo e sul riconoscimento dei reciproci confini.
L'auspicio che tutte le parti collaborino solidalmente - e che, in particolare, il pensiero scientifico e quello religioso comprendano reciprocamente le ragioni l'uno dell'altro - non è formulato da Habermas per la sola (e condivisibile) esigenza di salvaguardare lo Stato democratico; piuttosto, questo auspicio trae origine da valutazioni di carattere più generale. In particolare, secondo Habermas, le grandi religioni contemporanee dovrebbero essere fatte rientrare nella storia stessa della Ragione; la coscienza religiosa sarebbe infatti in grado di alimentare la consapevolezza di ciò che manca nella società umana, di mantenere desta la sensibilità verso ciò che è venuto meno, di preservare dall'oblio le dimensioni e il senso dell'umana convivenza. Potrebbero essere inoltre riferiti alla «compenetrazione tra il cristianesimo e la metafisica greca» tutti quei concetti che rendono possibile fissare norme per il comportamento e valutare le azioni: autonomia, responsabilità, giustificazione, alienazione, emancipazione, interiorizzazione, soggettività, istituzione, comunità, memoria, storia.
C'è tuttavia una condizione alla quale la coscienza religiosa dovrebbe sottostare, per adempiere al suo ruolo critico nel mondo contemporaneo: i credenti dovrebbero «avere imparato a porre le proprie convinzioni religiose in rapporto riflessivamente comprensivo con la realtà del pluralismo di religioni e visioni del mondo, e (dovrebbero) aver conciliato con la loro fede il privilegio conoscitivo delle scienze socialmente istituzionalizzate, come pure il primato dello Stato secolare e della morale sociale universalistica».
Che questo atteggiamento sia scontato è lo stesso Habermas a metterlo in dubbio: è esperienza di tutti i giorni che le convinzioni religiose giochino un ruolo di resistenza e di conservazione rispetto ai tentativi di far prevalere il primato dello Stato secolare e di stabilire una morale che tenga conto delle condizioni di tutti. Sicché, rispetto all'ideale collaborativo difeso da Habermas, è sempre bene ricordare la massima: «i progetti meglio fondati rimangono senza effetto, se la realtà non viene loro incontro».
Un esempio efficace delle difficoltà che si possono incontrare sul terreno al quale Habermas si riferisce è dato dalla discussione che - dai primi mesi del 2004 - si è andata sviluppando in Parlamento, sugli organi di stampa, alla televisione, a proposito dell'insegnamento della teoria dell'evoluzione nelle nostre scuole statali. Telmo Pievani, in un suo libro pubblicato quest'anno con il titolo In difesa di Darwin. Piccolo bestiario dell'antievoluzionismo all'italiana (Bompiani, 2007, pp. 123, euro 8), ne ricorda i passaggi essenziali. Il tema dell'evoluzione naturale era stato rimosso dai programmi delle scuole medie nel marzo del 2004, per disposizione dall'allora ministro Moratti. Di fronte alla protesta unanime della comunità scientifica, il tema venne parzialmente reinserito nei programmi scolastici nell'ottobre del 200, grazie anche al lavoro di un gruppo di esperti, presieduto da Rita Levi Montalcini. Le conclusioni effettive di questo gruppo e le trasformazioni subite dal suo documento finale costituiscono tuttora un mistero, sul quale Pievani riferisce con dovizia, nel primo capitolo del suo libro. È particolarmente interessante analizzare le ragioni addotte dagli antievoluzionisti nostrani, per porre in questione il valore conoscitivo di una teoria scientifica ben corroborata, caposaldo del pensiero contemporaneo, da tempo inserita nei programmi didattici di tutte le nazioni civili.
Queste ragioni si caratterizzano infatti per l'uso anti-scientifico di temi che emergono dall'ambito della ricerca scientifica stessa, o dalla riflessione razionale su di essa. Così, la distinzione metodologica tra fatti, teorie formali e interpretazioni - che è un risultato dell'epistemologia del primo '900 - è diventata per gli antievoluzionisti un appiglio per affermare che ogni teoria (e ogni interpretazione) ha la stessa plausibilità di qualsiasi altra (fermi restando eventualmente i dati empirici). Dal fatto poi che gli esseri umani rappresentano se stessi - entro certi limiti - come agenti liberi, gli antievoluzionisti concludono che il comportamento umano è, per i suoi aspetti essenziali, sostanzialmente indipendente dalle leggi naturali. Inoltre, visto che la capacità di costruire rappresentazioni (e soprattutto di giudicarle) è soggetta alla maturazione individuale (a partire dalla prima infanzia, fino alla maturità), i creazionisti concludono che l'insegnamento della teoria dell'evoluzione è inopportuno, nelle prime fasce d'età.
Ma il punto cruciale della discussione, al di là delle diatribe metodologiche, è questo: la presunta impossibilità di dar conto dell'evoluzione (in particolare del processo di costituzione delle strutture più complesse), a partire da eventi che si presentano in larga misura come aleatori. A tale proposito gli antievoluzionisti utilizzano spesso un argomento di questo genere: così come nessuno di noi riterrebbe possibile che un orologio si possa venire a formare spontanemente, grazie all'incontro casuale degli atomi che lo compongono, così noi dovremmo giudicare analogamente impossibile che - senza l'intervento di un progettista creatore - un sistema complesso come l'occhio umano si sia venuto a formare grazie all'incontro casuale di materiale indifferenziato.
Questa presunta impossibilità rimetterebbe in discussione la risposta che Pierre Simon de Laplace ebbe a dare a Napoleone Bonaparte, quando questi lo interrogò sul ruolo svolto da Dio, nel garantire l'ordine celeste: «Maestà, noi non abbiamo bisogno di questa ipotesi». Ricordando che il carattere aleatorio dei processi evolutivi è soggetto a stringenti vincoli di carattere deterministico, Pievani ammette che è senz'altro possibile immaginare lo zampino della Provvidenza in una sequenza di contingenze storiche difficilmente prevedibili; ma questa ipotesi, oltre a essere spuria, non è affatto necessaria.
Più in generale, anche nelle versioni più tolleranti (come quella del teologo svizzero Hans Küng, antico avversario dell'allora cardinale Ratzinger), l'anti-darwinismo dei credenti si nutre in genere del problema del senso: il naturalismo non sarebbe in grado, per il suo orientamento, di dare conto del senso del mondo e del senso dell'esistenza. Già: ma per quali motivi il mondo e l'esistenza dovrebbero avere un senso (ovvero un fine, oppure almeno una direzione extra-mondana)? Pievani ricorda che quello del naturalismo è soprattutto un programma di ricerca, e non è interessato a confrontarsi con le credenze religiose, a meno che queste non pretendano di fissare divieti e limitazioni a priori, circa gli obiettivi e la pratica della ricerca scientifica. Quando poi la polemica contro la teoria dell'evoluzione si accompagna ad altri aspetti molto preoccupanti (la svolta conservatrice dell'attuale papato; un sostanziale ripiegamento del cattolicesimo democratico; un crescente pressing mediatico contro il laicismo; l'affermarsi di correnti teo-dem; la fragilità delle risposte di parte laica), c'è davvero da chiedersi se l'ideale di collaborazione e di complementarità sostenuto da Habermas non sia per caso sospeso nel vuoto e se la realtà non sia più ottusa di come il filosofo tedesco la rappresenti.

Buona vita

Guglielmo

"Quieremos organizar lo entusiasmo, no la obediencia" - Buenaventura Durruti
Sal
Inviato: 8/9/2007 23:50  Aggiornato: 8/9/2007 23:56
Ho qualche dubbio
Iscritto: 11/3/2007
Da:
Inviati: 80
 Re: Gli anelli mancanti continuano ad aumentare
- citazione -
Avete ragione, nessuno ha riconosciuto che la teoria non esiste:

ASTRO - Mi chiedi come chiamare la teoria che spiega l'origine della comparsa della vita. Semplice:
non c'è una teoria scientifica che spiega la comparsa della vita. Tutto qui.

OLAH - Per quanto riguarda le teorie sulla nascita delle vita, è molto difficile dimostrare come sia avvenuta dato che non è un fenomeno riproducibile in laboratorio, almeno per il momento.

SLUMP - Secondo me invece ciò che è, anche probabilisticamente, più difficile spiegare è come si sia passati dal singolo protoorganismo unicellulare all'uomo attuale in un tempo tutto sommato non troppo lungo (500/600 milioni di anni si dice) e solo attraverso mutazioni assolutamente casuali

MORFEO: Da qui a chiedere di sviluppare un'intera teoria, con tutti i passaggi dal abiotico a Leonardo, altrimenti non possiamo dire male del turco, mi sembra alquanto esagrata come pretesa.

NOTTRZ: No, non c'e' una teoria che abbia ancora ricostruito/documentato tutti i numerosissimi micro passaggi da ameba a Leonardo.

Vado avanti? (nel senso che mi sono fermato a metà circa della rilettura).

Ragazzi, girateci intorno come volete, giocate con le parole, illudetevi che il problema sia Mazzucco, ma di qui non si scappa: voler sostenere che una cosa è avvenuta senza saper spiegare come sarebbe avvenuta è semplicemente ridicolo. Se poi è fatto con arroganza.....

(Adesso mi raccomando, ricominciate a dire che sono io che non ho capito.....)







Finché non comprendi i tuoi errori di metodo, è logico che ti si dica che non hai capito, ti pare? Vediamo punto per punto gli errori che hai commesso:

1) di tutte le citazioni che hai riportato solo Astro dice che non esiste una teoria, tutti gli altri dicono altro e ciò che ci sono difficoltà a dimostrare le teorie, che parlare di origine della vita e di teoria dell'evoluzione sono cose diverse (detto cento volte, ma ti ostini a non capirlo) e che non ci sono teorie che hanno spiegato nei particolari ogni minimo passaggio da una forma di vita all'altra. Il che è ben diverso dal dire che non esistono teorie in assoluto: le teorie esistono, non puoi ignorarle solo perché non ti soddisfano;

2) questo è un forum, cioè una piazza pubblica e non è che i partecipanti siano i rappresentanti ed esperti delle teorie evoluzionistiche, quindi che chi passa di qui non le conosca a menadito e non ti sappia rispondere non significa affatto che le risposte che cerchi non ci siano: vai a chiedere a luminari del campo invece di fare sondaggi d'opinione se davvero vuoi risposte valide ai tuoi dubbi;

3) e per l'ennesima volta: gli studi scientifici non si sono fermati, non è che quello che si conosce oggi sia tutto quello che mai si potrà sapere. Quindi è molto superficiale, ingenuo e gratuitamente maligno affermare, come sembri fare tu, che se qualcosa non è ben compreso oggi non lo sarà mai, e che quindi tutta la scienza va buttata nel cesso solo perché non riese a spiegare tutto nei più minimi dettagli. Dato anche che riescie a spiegare di più, e molto meglio, di qualsiasi altra disciplina.

ulivinico
Inviato: 12/10/2007 10:55  Aggiornato: 12/10/2007 10:55
Ho qualche dubbio
Iscritto: 19/10/2006
Da:
Inviati: 38
 Re: Gli anelli mancanti continuano ad aumentare
Cara REDAZIONE -citazione-
---
"""Anche il cattolico, credo, resterebbe sconcertato dal tuo dogmatismo. Permettimi, ma partire dal presupposto di avere ragione, per poi “restare sconcertati “ dalle idee altrui non è proprio da luogocomune.

E un pò come dire, “capisco il diritto alla libertà di pensiero, ma arrivare a credere che il governo americano si sia buttato giù da solo le torri gemelle è qualcosa di allucinante”. ""
---

Sulle Torri, si DIMOSTRA che son state buttate giù, basta il tempo di caduta e poi c'è la fisica che lo spiega con il teorema di conservazione dell'energia(per un ingegnere onesto basta quello).
Sulla creazione si DIMOSTRA che è un'invenzione, non è una mia opinione. Basta aver chiaro cosa è la creazione, dove è scritta, leggerla e via.

Io ho altre idee di opinioni, tipo se una donna è più bella di un altra...

Atvar
Inviato: 7/9/2008 18:02  Aggiornato: 7/9/2008 18:02
So tutto
Iscritto: 7/9/2008
Da:
Inviati: 5
 Re: Gli anelli mancanti continuano ad aumentare
Faccio solo notare che lo scoprire che c'è stato qualche ominide in più prima di noi, e che probabilmente sono esistite specie di ominidi diverse contemporaneamente non cambia assolutamente la teoria dell'evoluzione, anzi, non fa altro che confermarla.

Difatti, essa asserisce che l'evoluzione degli esseri viventi avviene tramite mutazioni spontanee, e che le mutazioni che rendono un organismo più abile a sopravvivere in un determinato ambiente lo avvantaggiano, permettendogli di riprodursi con maggiore efficenza, e quindi diffondendosi.

Il fatto che ci siano stati dei rami secchi nell'evoluzione degli ominidi (ovvero mutazioni che hanno portato all'evoluzione di specie poi estinte perchè meno adatte di altre) non inficia minimamente la teoria evoluzionistica, anzi, non fa che rafforzarla. Che poi invece a noi esseri umani piaccia pensare che sulla terra non ci sia stata altra forma di vita senziente oltre a noi è un'altra faccenda, anche un po' presuntuosa.

Tant'è che dalle ultime ricerche sembrerebbe che l'homo sapiens si sia evoluto in Africa e poi si sia trasferito in Europa, dove già viveva l'uomo di Neanderthal, specie evolutasi in loco. A quanto pare in una guerra fratricida durata circa 10 000 anni abbiamo sterminato il nostro parente e preso possesso del continente.

E ciò non contrasta la teoria dell'evoluzione, anzi, non fa altro che confermarla.


Powered by XOOPS 2.0 © 2001-2003 The XOOPS Project
Sponsor: Vorresti creare un sito web? Prova adesso con EditArea.   In cooperazione con Amazon.it   theme design: PHP-PROXIMA